DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3g1 and EMB140

DIOPT Version :9

Sequence 1:NP_570011.1 Gene:eIF3g1 / 31243 FlyBaseID:FBgn0029629 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_194158.3 Gene:EMB140 / 828529 AraportID:AT4G24270 Length:817 Species:Arabidopsis thaliana


Alignment Length:63 Identity:22/63 - (34%)
Similarity:30/63 - (47%) Gaps:1/63 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 RDDTAAIRISNLSESMTEADLEELVKKIGPQSKMYLARDKNTGLCKGFAYVHFKQRKDAAAAI 246
            ||:..|. |||||....|.|:.:.....|....:.:...|:||..:|.||..|...:..||||
plant   648 RDECTAF-ISNLSVKAQEEDIRKFFGDDGGVDSIRILHHKDTGKPRGLAYADFVDDEHLAAAI 709

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3g1NP_570011.1 eIF3g 30..140 CDD:289149
RRM <161..>269 CDD:223796 22/63 (35%)
RRM_eIF3G_like 189..265 CDD:240854 20/58 (34%)
EMB140NP_194158.3 RNA14 53..567 CDD:227438
RRM 561..>755 CDD:223796 22/63 (35%)
RRM 652..723 CDD:214636 20/59 (34%)
Lsm_interact 798..816 CDD:398843
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.