DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3g1 and LIF2

DIOPT Version :9

Sequence 1:NP_570011.1 Gene:eIF3g1 / 31243 FlyBaseID:FBgn0029629 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001031566.1 Gene:LIF2 / 827998 AraportID:AT4G00830 Length:495 Species:Arabidopsis thaliana


Alignment Length:263 Identity:58/263 - (22%)
Similarity:93/263 - (35%) Gaps:82/263 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DEVELDYGGLPPTTETVENGQ--KYVTEYKYNKDDKKTKVVRTYKISKQVVPKTVAKRRTWTKFG 75
            |.|:.:.|......:.||..|  :|..|.:.:.||..             |....|:.|....:|
plant     9 DRVDFEEGSYSEMEDEVEEEQVEEYEEEEEEDDDDDD-------------VGNQNAEEREVEDYG 60

  Fly    76 DSKNDKPGPNSQTTMVSEEIIMQFLNSKEDEKANDPLLDPTKNIAKCRICNGEHWSVNCPYKGTA 140
            |:|    |.:.:.  |.|||.....|..:.|.|:|.                             
plant    61 DTK----GGDMED--VQEEIAEDDDNHIDIETADDD----------------------------- 90

  Fly   141 MDTNMMEKKASAAAAAAVDAPKSGKY-----VPPFLKDSQKGALGMRGRDDTAAIRISNLSESMT 200
                  ||..|     .:|.....||     :||            .|.:    :.|..|...:.
plant    91 ------EKPPS-----PIDDEDREKYSHLLSLPP------------HGSE----VFIGGLPRDVG 128

  Fly   201 EADLEELVKKIGPQSKMYLARDKNTGLCKGFAYVHFKQRKDAAAAIEILNGHGYDHLILSVEWSK 265
            |.||.:|.::||...::.|.:|:::|..||:|:|.||.:..|..|||.|:...:....:....|:
plant   129 EEDLRDLCEEIGEIFEVRLMKDRDSGDSKGYAFVAFKTKDVAQKAIEELHSKEFKGKTIRCSLSE 193

  Fly   266 PQN 268
            .:|
plant   194 TKN 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3g1NP_570011.1 eIF3g 30..140 CDD:289149 21/111 (19%)
RRM <161..>269 CDD:223796 29/113 (26%)
RRM_eIF3G_like 189..265 CDD:240854 22/75 (29%)
LIF2NP_001031566.1 hnRNP-R-Q 112..>430 CDD:273732 27/101 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.