DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3g1 and CELF6

DIOPT Version :9

Sequence 1:NP_570011.1 Gene:eIF3g1 / 31243 FlyBaseID:FBgn0029629 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_443072.3 Gene:CELF6 / 60677 HGNCID:14059 Length:481 Species:Homo sapiens


Alignment Length:177 Identity:44/177 - (24%)
Similarity:66/177 - (37%) Gaps:21/177 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 PGPNSQTTMVSEEIIMQFLNSKE---DEKANDPLLDPTKNIAKCRI----CNGEHWSVNCPYKGT 139
            |||  ...|...:.|..|:....   ||:...||.:....|.:..:    ..|.|       ||.
Human    34 PGP--AVPMKDHDAIKLFVGQIPRGLDEQDLKPLFEEFGRIYELTVLKDRLTGLH-------KGC 89

  Fly   140 AMDTNMMEKKASAAAAAAVDAPKSGKYVPPFLKDSQKGALGMRGRDDTAAIRISNLSESMTEADL 204
            |..|..    |..:|..|..|....|.:|...:..|.......||.:...:.:..|.:...|.|:
Human    90 AFLTYC----ARDSALKAQSALHEQKTLPGMNRPIQVKPAASEGRGEDRKLFVGMLGKQQGEEDV 150

  Fly   205 EELVKKIGPQSKMYLARDKNTGLCKGFAYVHFKQRKDAAAAIEILNG 251
            ..|.:..|...:..:.|..: |..||.|:|.|..:.:|.|||..|:|
Human   151 RRLFQPFGHIEECTVLRSPD-GTSKGCAFVKFGSQGEAQAAIRGLHG 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3g1NP_570011.1 eIF3g 30..140 CDD:289149 15/64 (23%)
RRM <161..>269 CDD:223796 23/91 (25%)
RRM_eIF3G_like 189..265 CDD:240854 18/63 (29%)
CELF6NP_443072.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34 44/177 (25%)
RRM1_CELF3_4_5_6 41..127 CDD:241076 20/96 (21%)
ELAV_HUD_SF 48..477 CDD:273741 39/161 (24%)
RRM2_CELF3_4_5_6 133..213 CDD:241079 18/65 (28%)
RRM3_CELF3_4_5_6 392..470 CDD:241083
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.