DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3g1 and RBMS1

DIOPT Version :9

Sequence 1:NP_570011.1 Gene:eIF3g1 / 31243 FlyBaseID:FBgn0029629 Length:269 Species:Drosophila melanogaster
Sequence 2:XP_005246794.1 Gene:RBMS1 / 5937 HGNCID:9907 Length:422 Species:Homo sapiens


Alignment Length:140 Identity:36/140 - (25%)
Similarity:54/140 - (38%) Gaps:30/140 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 LLDPTKNIAKCRICNGEHWSVNCPYKGTAMDTNMMEKKASAAAAAAVDAPKSGKYVPPFLKDSQK 176
            :||.|.|  ||              ||    ...::..:.|||..||.|.|:........|..::
Human    94 ILDKTTN--KC--------------KG----YGFVDFDSPAAAQKAVSALKASGVQAQMAKQQEQ 138

  Fly   177 GALGMRGRDDTAAIRISNLSESMTEADLEELVKKIGPQSKMYLARDKNTGLCKGFAYVHFKQRKD 241
                     |...:.||||..||.|.:||.::|..|......:.|| ::|..:|..:...:..:.
Human   139 ---------DPTNLYISNLPLSMDEQELENMLKPFGQVISTRILRD-SSGTSRGVGFARMESTEK 193

  Fly   242 AAAAIEILNG 251
            ..|.|...||
Human   194 CEAVIGHFNG 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3g1NP_570011.1 eIF3g 30..140 CDD:289149 8/27 (30%)
RRM <161..>269 CDD:223796 22/91 (24%)
RRM_eIF3G_like 189..265 CDD:240854 19/63 (30%)
RBMS1XP_005246794.1 RRM1_MSSP1 55..140 CDD:409900 16/74 (22%)
RRM2_MSSP1 141..225 CDD:409903 19/64 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.