powered by:
Protein Alignment eIF3g1 and ndufs5
DIOPT Version :9
Sequence 1: | NP_570011.1 |
Gene: | eIF3g1 / 31243 |
FlyBaseID: | FBgn0029629 |
Length: | 269 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_012812490.1 |
Gene: | ndufs5 / 549928 |
XenbaseID: | XB-GENE-946984 |
Length: | 134 |
Species: | Xenopus tropicalis |
Alignment Length: | 34 |
Identity: | 11/34 - (32%) |
Similarity: | 14/34 - (41%) |
Gaps: | 1/34 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 141 MDTNMMEKKASAAAAAAVDAPKSGKY-VPPFLKD 173
|..|.:.::..|.........|.||| .|.|.||
Frog 97 MSRNKLRQRLQAIQEQKKKLEKEGKYKAPDFSKD 130
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.