DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3g1 and ncbp2

DIOPT Version :9

Sequence 1:NP_570011.1 Gene:eIF3g1 / 31243 FlyBaseID:FBgn0029629 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001006879.1 Gene:ncbp2 / 448671 XenbaseID:XB-GENE-1005786 Length:153 Species:Xenopus tropicalis


Alignment Length:115 Identity:36/115 - (31%)
Similarity:50/115 - (43%) Gaps:12/115 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 AVDAPKSGKYVPPFLKDSQKGALGMRG-RDD-------TAAIRISNLSESMTEADLEELVKKIGP 213
            |:.|.||..||    :.||......|| |.|       :..:.:.|||...||..:.||..|.|.
 Frog     2 ALGALKSDSYV----ELSQYRDQHFRGNRSDQECLLKHSCTLYVGNLSFYTTEEQIHELFSKSGD 62

  Fly   214 QSKMYLARDKNTGLCKGFAYVHFKQRKDAAAAIEILNGHGYDHLILSVEW 263
            ..|:.:..||......||.:|.:..|.||..|:..:||...|..|:..:|
 Frog    63 VKKIVMGLDKIKKTACGFCFVEYYTRTDAEQAMRFINGTRLDDRIIRTDW 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3g1NP_570011.1 eIF3g 30..140 CDD:289149
RRM <161..>269 CDD:223796 34/111 (31%)
RRM_eIF3G_like 189..265 CDD:240854 24/75 (32%)
ncbp2NP_001006879.1 RRM_NCBP2 39..116 CDD:240686 24/74 (32%)
mRNA cap-binding. /evidence=ECO:0000250 109..113 1/4 (25%)
mRNA cap-binding. /evidence=ECO:0000250 120..124
mRNA cap-binding. /evidence=ECO:0000250 130..131
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.