DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3g1 and Rox8

DIOPT Version :9

Sequence 1:NP_570011.1 Gene:eIF3g1 / 31243 FlyBaseID:FBgn0029629 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001262897.1 Gene:Rox8 / 42848 FlyBaseID:FBgn0005649 Length:470 Species:Drosophila melanogaster


Alignment Length:177 Identity:40/177 - (22%)
Similarity:73/177 - (41%) Gaps:26/177 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 VSEEIIMQFLNSKEDEKANDPLLDPTKNIAKCRICNGEHWSVNCPYKGTAMDTNMMEKKASAAAA 155
            |||::::...::          :.|.|:   |:|.....   |.||.       .:|.....||.
  Fly    18 VSEDLLIALFST----------MGPVKS---CKIIREPG---NDPYA-------FIEYSNYQAAT 59

  Fly   156 AAVDAPKSGKYVPPFLKDSQKGALGMRGRDDTAA---IRISNLSESMTEADLEELVKKIGPQSKM 217
            .|:.|.....::...:|.:...:.|.:.:.|.::   |.:.:||..:....|.|.....|..|..
  Fly    60 TALTAMNKRLFLEKEIKVNWATSPGNQPKTDISSHHHIFVGDLSPEIETETLREAFAPFGEISNC 124

  Fly   218 YLARDKNTGLCKGFAYVHFKQRKDAAAAIEILNGHGYDHLILSVEWS 264
            .:.||.:|...||:|:|.|.::.:|..||:.:||.......:...||
  Fly   125 RIVRDPHTMKSKGYAFVSFVKKAEAENAIQAMNGQWIGSRSIRTNWS 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3g1NP_570011.1 eIF3g 30..140 CDD:289149 10/48 (21%)
RRM <161..>269 CDD:223796 25/107 (23%)
RRM_eIF3G_like 189..265 CDD:240854 22/79 (28%)
Rox8NP_001262897.1 ELAV_HUD_SF 5..274 CDD:273741 40/177 (23%)
RRM1_TIA1_like 9..80 CDD:240798 16/84 (19%)
RRM2_TIA1_like 96..170 CDD:240799 20/73 (27%)
RRM3_TIA1_like 221..294 CDD:240800
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.