DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3g1 and tia1

DIOPT Version :9

Sequence 1:NP_570011.1 Gene:eIF3g1 / 31243 FlyBaseID:FBgn0029629 Length:269 Species:Drosophila melanogaster
Sequence 2:XP_012814227.2 Gene:tia1 / 394890 XenbaseID:XB-GENE-1002876 Length:389 Species:Xenopus tropicalis


Alignment Length:189 Identity:43/189 - (22%)
Similarity:73/189 - (38%) Gaps:33/189 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 VSEEIIMQFLNSKEDEKANDPLLDPTKNIAKCRICNGEHWSVNCPYKGTAMDTNMMEKKASAAAA 155
            |:|.:|:|..:.....|:...::|...|...|.:                   ...|.:.:||:.
 Frog    18 VTEPLILQVFSQLGPCKSCKMIMDTAGNDPYCFV-------------------EFFEHRHAAASL 63

  Fly   156 AAVDAPK-SGKYV-------PPFLK---DSQKGALGMRGRDDTAAIRISNLSESMTEADLEELVK 209
            ||::..| .||.|       |...|   :|......:|.:|. ..:.:.:||..:|..|::....
 Frog    64 AAMNGRKIMGKEVKVNWATTPSSQKKDANSSSVVSTLRSQDH-FHVFVGDLSPEITTDDIKAAFA 127

  Fly   210 KIGPQSKMYLARDKNTGLCKGFAYVHFKQRKDAAAAIEILNGHGYDHLILSVEWS--KP 266
            ..|..|...:.:|..||..||:.:|.|..:.||..||..:.|.......:...|:  ||
 Frog   128 PFGRISDARVVKDMTTGKSKGYGFVSFFNKWDAENAIAQMGGQWLGGRQIRTNWATRKP 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3g1NP_570011.1 eIF3g 30..140 CDD:289149 8/48 (17%)
RRM <161..>269 CDD:223796 30/119 (25%)
RRM_eIF3G_like 189..265 CDD:240854 19/77 (25%)
tia1XP_012814227.2 RRM1_TIA1 8..81 CDD:410027 17/81 (21%)
RRM2_TIA1 104..181 CDD:410030 19/77 (25%)
RRM3_TIAR 214..286 CDD:241064
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.