DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3g1 and CG3335

DIOPT Version :9

Sequence 1:NP_570011.1 Gene:eIF3g1 / 31243 FlyBaseID:FBgn0029629 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_648337.1 Gene:CG3335 / 39119 FlyBaseID:FBgn0036018 Length:918 Species:Drosophila melanogaster


Alignment Length:120 Identity:38/120 - (31%)
Similarity:56/120 - (46%) Gaps:16/120 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 APKSGKYVPPFLKDS-------QKGALGMRGRDD---TAAIRISNLSESMTEADLEELVKKIGPQ 214
            |.|||:.:.|...|:       |:.:|..  .||   :..|...||:.:.||.||.:|.::.||.
  Fly   328 ASKSGQPLAPAAVDAGNAKWKHQQDSLSK--EDDISESGRIFFRNLAYTTTEEDLRKLFEQFGPV 390

  Fly   215 SKMYLARDKNTGLCKGFAYVHFKQRKDAAAAIEILNG---HG-YDHLILSVEWSK 265
            .::.|..||.|...|||..|.:...:.|..|...|:|   || ..||:.|.:..|
  Fly   391 VEVNLPLDKLTRKIKGFGTVTYMMPEHALKAFNTLDGTDFHGRLLHLLPSKDIEK 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3g1NP_570011.1 eIF3g 30..140 CDD:289149
RRM <161..>269 CDD:223796 37/119 (31%)
RRM_eIF3G_like 189..265 CDD:240854 27/79 (34%)
CG3335NP_648337.1 RRM1_RBM19 2..77 CDD:241008
RRM_SF 250..314 CDD:302621
RRM3_RBM19 362..440 CDD:241011 26/77 (34%)
RRM4_RBM19 552..623 CDD:241013
RRM <638..845 CDD:223796
RRM5_RBM19_like 679..760 CDD:240764
RRM6_RBM19 785..864 CDD:241015
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.