DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3g1 and TBPH

DIOPT Version :10

Sequence 1:NP_570011.1 Gene:eIF3g1 / 31243 FlyBaseID:FBgn0029629 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_477400.1 Gene:TBPH / 37781 FlyBaseID:FBgn0025790 Length:531 Species:Drosophila melanogaster


Alignment Length:172 Identity:34/172 - (19%)
Similarity:57/172 - (33%) Gaps:49/172 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 MQFLNSKEDEKANDPLLDPTKNIAKCRICNGE-HWSVNCPYKGTAMDTNMMEKKASAAAAAAVDA 160
            |.|:...|:| .::|:..|.:......:...: .:..:|..|...:||..:....|         
  Fly     1 MDFVQVSEEE-GDEPIELPAEEDGTLLLSTLQAQFPGSCGLKYRNLDTKAVRGVRS--------- 55

  Fly   161 PKSGKYVPP--------------FLKDSQKGALGMRGRDD-----TAAIR------------ISN 194
             ..|:..||              |.|:::      |..||     ||..:            :..
  Fly    56 -NEGRLFPPSVESGWGEYAYFCVFPKENK------RKSDDNLENSTAKTKRIETRLRCTDLIVLG 113

  Fly   195 LSESMTEADLEELVKKIGPQSKMYLARDKNTGLCKGFAYVHF 236
            |....||..|.|..:..|......:.:|..:|..|||.:|.|
  Fly   114 LPWKTTEESLREYFETYGEVLMAQIKKDTKSGQSKGFGFVRF 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3g1NP_570011.1 eIF3g 23..140 CDD:463545 8/43 (19%)
RRM_eIF3G_like 190..264 CDD:409842 13/59 (22%)
TBPHNP_477400.1 TDP43_N 3..78 CDD:465833 13/85 (15%)
RRM1_TDP43 108..181 CDD:409760 13/48 (27%)
RRM2_TDP43 192..261 CDD:409761
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.