DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3g1 and Rbp9

DIOPT Version :9

Sequence 1:NP_570011.1 Gene:eIF3g1 / 31243 FlyBaseID:FBgn0029629 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001259974.1 Gene:Rbp9 / 33498 FlyBaseID:FBgn0010263 Length:684 Species:Drosophila melanogaster


Alignment Length:283 Identity:63/283 - (22%)
Similarity:113/283 - (39%) Gaps:44/283 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ETIKSSWADEVELDYGGLPPTTETVENGQKYVTEYKYN--KDDKKT------KVVRTYKISKQV- 60
            :|||.|.|          .|::|:::....||:....|  :.|.::      |::.:..:...: 
  Fly   179 KTIKVSIA----------RPSSESIKGANLYVSGLPKNMTQSDLESLFSPYGKIITSRILCDNIT 233

  Fly    61 -VPKTVAKRRTWTKFGDSKNDKPGPNSQTTMVSEEIIMQFLNSKEDEKANDPLLDPTKNIAKCRI 124
             :.|.|...|...:|...:..|....:.....:|.|.::|.|:....|.:   :.|.......:.
  Fly   234 GLSKGVGFIRFDQRFEADRAIKELNGTTPKNSTEPITVKFANNPSSNKNS---MQPLAAYIAPQN 295

  Fly   125 CNGEHWSVNCPYKGTAMDTNMMEKKASAAAAAAVDAPKSGKY------VPPFLKDSQKGALGMRG 183
            ..|          |.|...|.....|:||||||:. |.:|:|      ..|...|.....: ::|
  Fly   296 TRG----------GRAFPANAAAGAAAAAAAAAIH-PNAGRYSSVISRYSPLTSDLITNGM-IQG 348

  Fly   184 RDDTAA---IRISNLSESMTEADLEELVKKIGPQSKMYLARDKNTGLCKGFAYVHFKQRKDAAAA 245
            ....::   |.:.||:....|..|.:|....|....:.:.||..:..||||.:|.....::|..|
  Fly   349 NTIASSGWCIFVYNLAPDTEENVLWQLFGPFGAVQSVKVIRDLQSNKCKGFGFVTMTNYEEAVLA 413

  Fly   246 IEILNGHGYDHLILSVEWSKPQN 268
            |:.|||:...:.:|.|.:...:|
  Fly   414 IQSLNGYTLGNRVLQVSFKTNKN 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3g1NP_570011.1 eIF3g 30..140 CDD:289149 18/119 (15%)
RRM <161..>269 CDD:223796 29/117 (25%)
RRM_eIF3G_like 189..265 CDD:240854 22/78 (28%)
Rbp9NP_001259974.1 ELAV_HUD_SF 107..438 CDD:273741 63/283 (22%)
RRM1_Hu 109..186 CDD:241094 4/6 (67%)
RRM2_Hu 196..274 CDD:241096 12/77 (16%)
RRM3_Hu 355..432 CDD:240823 22/76 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10352
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.