DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment eIF3g1 and pabpc1l

DIOPT Version :9

Sequence 1:	NP_570011.1	Gene:	eIF3g1 / 31243	FlyBaseID:	FBgn0029629	Length:	269	Species:	Drosophila melanogaster
Sequence 2:	NP_956133.1	Gene:	pabpc1l / 327625	ZFINID:	ZDB-GENE-030131-5836	Length:	620	Species:	Danio rerio

Alignment Length:	78	Identity:	21/78 - (26%)
Similarity:	39/78 - (50%)	Gaps:	0/78 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   188 AAIRISNLSESMTEADLEELVKKIGPQSKMYLARDKNTGLCKGFAYVHFKQRKDAAAAIEILNGH 252
            |::.:.:|...:|||.|.:.....|....:.:.||..|....|:||::|:|..||..|::.:|..
Zfish    11 ASLYVGDLHADVTEAMLYQKFSPAGQIMSIRVCRDVITRRSLGYAYINFQQPADAECALDTMNYE 75

  Fly   253 GYDHLILSVEWSK 265
            ......:.:.||:
Zfish    76 VIKGRPIRIMWSQ 88

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
eIF3g1	NP_570011.1	eIF3g	30..140	CDD:289149
		RRM	<161..>269	CDD:223796	21/78 (27%)
		RRM_eIF3G_like	189..265	CDD:240854	19/75 (25%)
pabpc1l	NP_956133.1	PABP-1234	11..610	CDD:130689	21/78 (27%)
		RRM1_I_PABPs	12..91	CDD:240824	20/77 (26%)
		RRM2_I_PABPs	97..172	CDD:240825
		RRM3_I_PABPs	190..269	CDD:240826
		RRM4_I_PABPs	293..370	CDD:240827
		PABP	542..609	CDD:279051
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.910