DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3g1 and Celf5

DIOPT Version :9

Sequence 1:NP_570011.1 Gene:eIF3g1 / 31243 FlyBaseID:FBgn0029629 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001361632.1 Gene:Celf5 / 319586 MGIID:2442333 Length:446 Species:Mus musculus


Alignment Length:135 Identity:33/135 - (24%)
Similarity:55/135 - (40%) Gaps:17/135 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 YKGTAMDTNMMEKKASAAAAAAVDAPKSGKYVPPFLKDSQKGALGMRGRDDTAAIRISNLSESMT 200
            :.|....|.|....|.|..|.:|..|      |..|:..::|..|..       :.|.:|.:...
Mouse   322 FSGVQQYTAMYPTAAIAPVAHSVPQP------PHLLQQQREGPEGCN-------LFIYHLPQEFG 373

  Fly   201 EADLEELVKKIGP--QSKMYLARDKNTGLCKGFAYVHFKQRKDAAAAIEILNGHGYDHLILSVEW 263
            :.:|.::....|.  .||:::.|..|...|  |.:|.|.....|.|||:.:||.......|.|:.
Mouse   374 DTELTQMFLPFGNIISSKVFMDRATNQSKC--FGFVSFDHPASAQAAIQAMNGFQIGMKRLKVQL 436

  Fly   264 SKPQN 268
            .:|::
Mouse   437 KRPKD 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3g1NP_570011.1 eIF3g 30..140 CDD:289149 1/3 (33%)
RRM <161..>269 CDD:223796 26/110 (24%)
RRM_eIF3G_like 189..265 CDD:240854 20/77 (26%)
Celf5NP_001361632.1 RRM1_CELF3_4_5_6 2..88 CDD:241076
PABP-1234 <9..358 CDD:130689 10/41 (24%)
RRM2_CELF3_4_5_6 95..175 CDD:241079
RRM3_CELF3_4_5_6 357..435 CDD:241083 21/86 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.