DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3g1 and HNRNPA1

DIOPT Version :9

Sequence 1:NP_570011.1 Gene:eIF3g1 / 31243 FlyBaseID:FBgn0029629 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_112420.1 Gene:HNRNPA1 / 3178 HGNCID:5031 Length:372 Species:Homo sapiens


Alignment Length:151 Identity:35/151 - (23%)
Similarity:57/151 - (37%) Gaps:38/151 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 EHWSVNCPYKGTAMDTNMME----KKA------SAAAAAAVDAPKS-------GKYVPP----FL 171
            |.|       ||..|..:|.    |::      :.|....|||..:       |:.|.|    ..
Human    35 EQW-------GTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSR 92

  Fly   172 KDSQKGALGMRGRDDTAAIRISNLSESMTEADLEELVKKIGPQSKMYLARDKNTGLCKGFAYVHF 236
            :|||:....:    ....|.:..:.|...|..|.:..::.|....:.:..|:.:|..:|||:|.|
Human    93 EDSQRPGAHL----TVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTF 153

  Fly   237 KQRKDAAAAIEI-----LNGH 252
            ... |:...|.|     :|||
Human   154 DDH-DSVDKIVIQKYHTVNGH 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3g1NP_570011.1 eIF3g 30..140 CDD:289149 3/11 (27%)
RRM <161..>269 CDD:223796 24/108 (22%)
RRM_eIF3G_like 189..265 CDD:240854 18/69 (26%)
HNRNPA1NP_112420.1 Globular A domain 4..94 14/65 (22%)
RRM1_hnRNPA1 12..92 CDD:410154 14/63 (22%)
Globular B domain 95..185 20/84 (24%)
RRM2_hnRNPA3 105..184 CDD:409996 18/70 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 182..216
RNA-binding RGG-box 218..240
HnRNPA1 307..344 CDD:402981
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 317..372
Nuclear targeting sequence (M9) 320..357
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.