DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3g1 and elav

DIOPT Version :9

Sequence 1:NP_570011.1 Gene:eIF3g1 / 31243 FlyBaseID:FBgn0029629 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001245447.1 Gene:elav / 31000 FlyBaseID:FBgn0260400 Length:483 Species:Drosophila melanogaster


Alignment Length:282 Identity:72/282 - (25%)
Similarity:103/282 - (36%) Gaps:58/282 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ETIKSSWA----DEVE---LDYGGLPPTTETVE-------NGQKYVTEYKYNK-DDKKTKVVRTY 54
            :|||.|:|    |.::   |...|||.|....|       .|....:....|. :|.:||.|...
  Fly   231 KTIKVSFARPSSDAIKGANLYVSGLPKTMTQQELEAIFAPFGAIITSRILQNAGNDTQTKGVGFI 295

  Fly    55 KISKQVVPKTVAKRRTWTKFGDSKNDKPGPNSQTTMVSEEIIMQFLNSK-EDEKANDPLLDPTKN 118
            :..|    :..|.|......|.:      |:|.|    :.|:::|.|:. ...|...|.|....|
  Fly   296 RFDK----REEATRAIIALNGTT------PSSCT----DPIVVKFSNTPGSTSKIIQPQLPAFLN 346

  Fly   119 IAKCRICNGE-HWSVN------CPYKGTAMDTNMMEKKASAAAAAAVDAPKSGKYVPPFLKDSQK 176
            ....|...|. |..||      .|..|..:|..:.....:|||||...|...|...|.|      
  Fly   347 PQLVRRIGGAMHTPVNKGLARFSPMAGDMLDVMLPNGLGAAAAAATTLASGPGGAYPIF------ 405

  Fly   177 GALGMRGRDDTAAIRISNLSESMTEADLEELVKKIGPQSKMYLARDKNTGLCKGFAYVHFKQRKD 241
                           |.||:....||.|.:|....|....:.:.:|..|..|||:.:|......:
  Fly   406 ---------------IYNLAPETEEAALWQLFGPFGAVQSVKIVKDPTTNQCKGYGFVSMTNYDE 455

  Fly   242 AAAAIEILNGHGYDHLILSVEW 263
            ||.||..|||:...:.:|.|.:
  Fly   456 AAMAIRALNGYTMGNRVLQVSF 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3g1NP_570011.1 eIF3g 30..140 CDD:289149 28/125 (22%)
RRM <161..>269 CDD:223796 26/103 (25%)
RRM_eIF3G_like 189..265 CDD:240854 23/75 (31%)
elavNP_001245447.1 ELAV_HUD_SF 146..483 CDD:273741 72/282 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10352
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.