DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3g1 and Elavl3

DIOPT Version :9

Sequence 1:NP_570011.1 Gene:eIF3g1 / 31243 FlyBaseID:FBgn0029629 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_758827.1 Gene:Elavl3 / 282824 RGDID:628892 Length:367 Species:Rattus norvegicus


Alignment Length:284 Identity:69/284 - (24%)
Similarity:106/284 - (37%) Gaps:57/284 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ETIKSSWA-------DEVELDYGGLPPTTETVENGQKYVTEYKYNKD-------DKKTKVVR--- 52
            :|||.|:|       .:..|...|||.|....|..|.:   .:|.:.       |:.|.|.|   
  Rat   108 KTIKVSYARPSSASIRDANLYVSGLPKTMSQKEMEQLF---SQYGRIITSRILLDQATGVSRGVG 169

  Fly    53 TYKISKQVVPKTVAKRRTWTKFGDSKNDKPGPNSQTTM-VSEEIIMQFLNSKEDEKANDPLLDPT 116
            ..:..|::..:...|               |.|.|..: .:|.|.::|.|: ..:|....||...
  Rat   170 FIRFDKRIEAEEAIK---------------GLNGQKPLGAAEPITVKFANN-PSQKTGQALLTHL 218

  Fly   117 KNIAKCRICNGEHWSVNCPYKGTAMDTNMMEKKASAAAAAAVDAPKS--GKYVPPFLKDSQKGAL 179
            ...:..|.....|...    :...:| |::.      .|..|.:|.|  .:: .|...|...|..
  Rat   219 YQSSARRYAGPLHHQT----QRFRLD-NLLN------MAYGVKSPLSLIARF-SPIAIDGMSGLA 271

  Fly   180 GMRGRDDTAA-----IRISNLSESMTEADLEELVKKIGPQSKMYLARDKNTGLCKGFAYVHFKQR 239
            |: |....||     |.:.|||....|:.|.:|....|..:.:.:.||..|..||||.:|.....
  Rat   272 GV-GLSGGAAGAGWCIFVYNLSPEADESVLWQLFGPFGAVTNVKVIRDFTTNKCKGFGFVTMTNY 335

  Fly   240 KDAAAAIEILNGHGYDHLILSVEW 263
            .:||.||..|||:.....:|.|.:
  Rat   336 DEAAMAIASLNGYRLGERVLQVSF 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3g1NP_570011.1 eIF3g 30..140 CDD:289149 21/120 (18%)
RRM <161..>269 CDD:223796 34/110 (31%)
RRM_eIF3G_like 189..265 CDD:240854 26/80 (33%)
Elavl3NP_758827.1 ELAV_HUD_SF 36..366 CDD:273741 69/284 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.