DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3g1 and rnp24

DIOPT Version :9

Sequence 1:NP_570011.1 Gene:eIF3g1 / 31243 FlyBaseID:FBgn0029629 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_594970.1 Gene:rnp24 / 2542965 PomBaseID:SPAC3G6.04 Length:369 Species:Schizosaccharomyces pombe


Alignment Length:285 Identity:59/285 - (20%)
Similarity:99/285 - (34%) Gaps:83/285 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 TTETVENGQKYVTEYKYNKDDKKTK-VVRTYKISKQVVPKTVAKRRTW----------------- 71
            |.|.:|..:|        |::|:.| :...|...::...:..:||..|                 
pombe    66 TPEALEEAKK--------KEEKRLKRLDAKYGRKEEGESQEESKRSPWGIWVGNLSFHTTKEILT 122

  Fly    72 ----------TKFGDSKNDKPGPNSQTTMVSEEIIMQFLNSKEDEKANDPLL-------DPTKNI 119
                      .|....:|.||....|.|.:...:      |||....|....       |..|..
pombe   123 DFFVRETSEMIKEVSEENIKPITTEQITRIHMPM------SKEKRFQNKGFAYVDFATEDALKLA 181

  Fly   120 AKC--RICNGEHWSV--NCPYKG-TAMDTNMMEKKASAAAAAAVDAPKSGKYVPPFLKDSQKGAL 179
            .:|  :..||.:..:  |..:.| .:...|.:.|.||                   ::.|:|   
pombe   182 LQCSEKALNGRNILIKSNTDFSGRPSKPANTLSKTAS-------------------IQSSKK--- 224

  Fly   180 GMRGRDDTAAIRISNLSESMTEADLEELVKKIGPQSKMYLARDKNTGLCKGFAYVHFKQRKDAAA 244
                 :.::.:.:.||....|:|||:|...::|...::.|...::||.||||.:|.|........
pombe   225 -----EPSSILFVGNLDFETTDADLKEHFGQVGQIRRVRLMTFEDTGKCKGFGFVDFPDIDTCMK 284

  Fly   245 AIEILNGHGYDHLILSVEWSKPQNN 269
            |:|:  ||....|....:.||...|
pombe   285 AMEL--GHNSWRLEYGEDRSKRMRN 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3g1NP_570011.1 eIF3g 30..140 CDD:289149 26/149 (17%)
RRM <161..>269 CDD:223796 26/107 (24%)
RRM_eIF3G_like 189..265 CDD:240854 22/75 (29%)
rnp24NP_594970.1 RRM 9..308 CDD:223796 59/285 (21%)
RRM1_Nop13p_fungi 107..199 CDD:240842 15/97 (15%)
RRM2_Nop13p_fungi 230..299 CDD:240843 22/70 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.