DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3g1 and gar2

DIOPT Version :9

Sequence 1:NP_570011.1 Gene:eIF3g1 / 31243 FlyBaseID:FBgn0029629 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_593531.1 Gene:gar2 / 2542869 PomBaseID:SPAC140.02 Length:500 Species:Schizosaccharomyces pombe


Alignment Length:301 Identity:67/301 - (22%)
Similarity:110/301 - (36%) Gaps:66/301 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KSSWADEVELDYGGLPPTTETVENGQKYVTEYKYNKDDKKTKVVRTYKISKQVVPKTVAKRRTWT 72
            :||.:.|.|.:...:....|..|:.....:|...::.:.::....:.: .::||.||..|:...:
pombe   139 ESSSSSESEEEEEAVVKIEEKKESSSDSSSESSSSESESESSSSESEE-EEEVVEKTEEKKEGSS 202

  Fly    73 K-------FGDSKNDKPGPNSQTTMVSEEIIMQFLNSKEDEKAN--DPLLD--PTKNIAK----- 121
            :       ..||.::....:|.:...||       :|.||||..  :|..:  |.| |.|     
pombe   203 ESSSDSESSSDSSSESGDSDSSSDSESE-------SSSEDEKKRKAEPASEERPAK-ITKPSQDS 259

  Fly   122 ---CRICNGE-HWSVNCPYKG-------------TAMDTNM----------MEKKASAAAAAAVD 159
               |.:..|. .|:|:..:.|             ..||...          .|...:|.||.|.:
pombe   260 NETCTVFVGRLSWNVDDQWLGQEFEEYGTIVGARVIMDGQSGRSKGYGYVDFETPEAAKAAVAAN 324

  Fly   160 APK--SGKYV-----------PPFLKDSQKGALGMRGRDDTAAIRISNLSESMTEADLEELVKKI 211
            ..|  .|:.|           |......:.|..|.:..:.:..:.:.|||.:.||.||.......
pombe   325 GTKEIDGRMVNLDLSNPRPANPQPYAQQRAGNFGDQLSEPSDTVFVGNLSFNATEDDLSTAFGGC 389

  Fly   212 GPQSKMYLARDKNTGLCKGFAYVHFKQRKDAAAAIEILNGH 252
            |....:.|..|..:|..|||.||.|.....|...:| :|||
pombe   390 GDIQSIRLPTDPQSGRLKGFGYVTFSDIDSAKKCVE-MNGH 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3g1NP_570011.1 eIF3g 30..140 CDD:289149 27/142 (19%)
RRM <161..>269 CDD:223796 28/105 (27%)
RRM_eIF3G_like 189..265 CDD:240854 22/64 (34%)
gar2NP_593531.1 RRM1_gar2 264..339 CDD:240893 14/74 (19%)
RRM2_gar2 368..439 CDD:240894 22/63 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.