DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3g1 and tcg1

DIOPT Version :9

Sequence 1:NP_570011.1 Gene:eIF3g1 / 31243 FlyBaseID:FBgn0029629 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_595090.2 Gene:tcg1 / 2541062 PomBaseID:SPBC660.11 Length:349 Species:Schizosaccharomyces pombe


Alignment Length:277 Identity:64/277 - (23%)
Similarity:108/277 - (38%) Gaps:52/277 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ADEVELDYGGLPPTTETVENGQKYVTEYKYNKDDKKTKVVRTYKISKQVVPKTVA-----KRRTW 71
            ||:..:..|.|..:|:..|....:.|   .....|.|...|..:...::||..:|     .:...
pombe    42 ADDFRVFVGRLSTSTKKSEIRSLFET---VGTVRKVTIPFRRVRRGTRLVPSGIAFVTFNNQEDV 103

  Fly    72 TKFGDSKNDKPGPNSQTTMVSEEIIMQFLNSKEDEKANDPLLDPTKNIAKCRICNGEHWSVNCPY 136
            .|..::.|.|       |:...||::|        ||......|.|:..|.:..|||.     |.
pombe   104 DKAIETLNGK-------TLDDREIVVQ--------KARPVQEQPIKDRKKSKNKNGEE-----PE 148

  Fly   137 KGTAMDTNMMEKKASA--AAAAAVDAPKSGKYVPPFLKDSQKGALGMRGRDDTA-----AIRISN 194
            ..|::: |....|.|:  ..|....||.|.:......|.::....|..|::...     :|.:|.
pombe   149 TSTSVE-NAESAKGSSDENEANTATAPSSNEANGVDKKQNEIKGKGGSGKNKAKPLPPNSIYVSG 212

  Fly   195 LSESMTEADLEEL------------VKKIGPQ--SKMYLARDKNTGLCKGFAYVHFKQRKDAAAA 245
            ||.::|...|:|:            |:.:.|.  .::.|..::..|  :||.:|.|...:|.:.|
pombe   213 LSVTLTNEGLKEMFDAYNPTRARIAVRSLPPYIIRRIKLRGEQRRG--RGFGFVSFANAEDQSRA 275

  Fly   246 IEILNGHGYDHLILSVE 262
            ||.:||.....|.|.|:
pombe   276 IEEMNGKQVGDLTLVVK 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3g1NP_570011.1 eIF3g 30..140 CDD:289149 24/114 (21%)
RRM <161..>269 CDD:223796 29/121 (24%)
RRM_eIF3G_like 189..265 CDD:240854 24/88 (27%)
tcg1NP_595090.2 RRM_SF 46..124 CDD:302621 18/95 (19%)
RRM 207..291 CDD:214636 23/85 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.