DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3g1 and Pabpc4

DIOPT Version :9

Sequence 1:NP_570011.1 Gene:eIF3g1 / 31243 FlyBaseID:FBgn0029629 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_570951.2 Gene:Pabpc4 / 230721 MGIID:2385206 Length:660 Species:Mus musculus


Alignment Length:165 Identity:42/165 - (25%)
Similarity:77/165 - (46%) Gaps:20/165 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 IIMQFLNSKEDEKANDPLLDPTKNIAKCRICNGEHWSVNCPYKGTAMDTNMMEKKASAAAAAAVD 159
            :.::.|:...|.||.........||..|::...|:.|     ||.|    .:..:...||..|::
Mouse   101 VFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENGS-----KGYA----FVHFETQEAADKAIE 156

  Fly   160 APKSGK-------YVPPFLKDSQKGA-LGMRGRDDTAAIRISNLSESMTEADLEELVKKIGPQSK 216
             ..:|.       :|..|....::.| ||.:.::.| .:.|.|..|.:.:.:|:||..:.|....
Mouse   157 -KMNGMLLNDRKVFVGRFKSRKEREAELGAKAKEFT-NVYIKNFGEEVDDGNLKELFSQFGKTLS 219

  Fly   217 MYLARDKNTGLCKGFAYVHFKQRKDAAAAIEILNG 251
            :.:.|| ::|..|||.:|.:::.:||..|:|.:||
Mouse   220 VKVMRD-SSGKSKGFGFVSYEKHEDANKAVEEMNG 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3g1NP_570011.1 eIF3g 30..140 CDD:289149 11/44 (25%)
RRM <161..>269 CDD:223796 27/99 (27%)
RRM_eIF3G_like 189..265 CDD:240854 20/63 (32%)
Pabpc4NP_570951.2 PABP-1234 11..640 CDD:130689 42/165 (25%)
RRM1_I_PABPs 12..91 CDD:240824
RRM2_I_PABPs 97..172 CDD:240825 17/80 (21%)
RRM3_I_PABPs 190..269 CDD:240826 21/66 (32%)
RRM4_I_PABPs 293..370 CDD:240827
PABP 572..639 CDD:279051
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.