powered by:
Protein Alignment eIF3g1 and cpf-2
DIOPT Version :9
Sequence 1: | NP_570011.1 |
Gene: | eIF3g1 / 31243 |
FlyBaseID: | FBgn0029629 |
Length: | 269 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_499734.1 |
Gene: | cpf-2 / 176742 |
WormBaseID: | WBGene00000774 |
Length: | 336 |
Species: | Caenorhabditis elegans |
Alignment Length: | 74 |
Identity: | 20/74 - (27%) |
Similarity: | 37/74 - (50%) |
Gaps: | 0/74 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 189 AIRISNLSESMTEADLEELVKKIGPQSKMYLARDKNTGLCKGFAYVHFKQRKDAAAAIEILNGHG 253
::.:.|:|..::|..:..:..|.|....:.:..|:.||..||:.::.|...:.|..||..|||:.
Worm 19 SVFVGNISYDVSEDTIRSIFSKAGNVLSIKMVHDRETGKPKGYGFIEFPDIQTAEVAIRNLNGYE 83
Fly 254 YDHLILSVE 262
....||.|:
Worm 84 LSGRILRVD 92
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.