DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3g1 and cpf-2

DIOPT Version :9

Sequence 1:NP_570011.1 Gene:eIF3g1 / 31243 FlyBaseID:FBgn0029629 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_499734.1 Gene:cpf-2 / 176742 WormBaseID:WBGene00000774 Length:336 Species:Caenorhabditis elegans


Alignment Length:74 Identity:20/74 - (27%)
Similarity:37/74 - (50%) Gaps:0/74 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 AIRISNLSESMTEADLEELVKKIGPQSKMYLARDKNTGLCKGFAYVHFKQRKDAAAAIEILNGHG 253
            ::.:.|:|..::|..:..:..|.|....:.:..|:.||..||:.::.|...:.|..||..|||:.
 Worm    19 SVFVGNISYDVSEDTIRSIFSKAGNVLSIKMVHDRETGKPKGYGFIEFPDIQTAEVAIRNLNGYE 83

  Fly   254 YDHLILSVE 262
            ....||.|:
 Worm    84 LSGRILRVD 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3g1NP_570011.1 eIF3g 30..140 CDD:289149
RRM <161..>269 CDD:223796 20/74 (27%)
RRM_eIF3G_like 189..265 CDD:240854 20/74 (27%)
cpf-2NP_499734.1 RRM_CSTF2_RNA15_like 20..94 CDD:240844 20/73 (27%)
CSTF2_hinge 115..194 CDD:373015
CSTF_C 299..334 CDD:373006
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.