DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3g1 and exc-7

DIOPT Version :9

Sequence 1:NP_570011.1 Gene:eIF3g1 / 31243 FlyBaseID:FBgn0029629 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_496057.1 Gene:exc-7 / 174506 WormBaseID:WBGene00001368 Length:456 Species:Caenorhabditis elegans


Alignment Length:87 Identity:26/87 - (29%)
Similarity:44/87 - (50%) Gaps:1/87 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 GRDDTAAIRISNLSESMTEADLEELVKKIGPQSKMYLARDKNTGLCKGFAYVHFKQRKDAAAAIE 247
            |...|..| |:.|.:.||:.::..|...||......|.|||.||...|:.:|::.:.:||..|:.
 Worm    38 GESKTNLI-INYLPQGMTQEEVRSLFTSIGEIESCKLVRDKVTGQSLGYGFVNYVREEDALRAVS 101

  Fly   248 ILNGHGYDHLILSVEWSKPQNN 269
            ..||....:..:.|.:::|.|:
 Worm   102 SFNGLRLQNKTIKVSYARPSND 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3g1NP_570011.1 eIF3g 30..140 CDD:289149
RRM <161..>269 CDD:223796 25/85 (29%)
RRM_eIF3G_like 189..265 CDD:240854 22/75 (29%)
exc-7NP_496057.1 ELAV_HUD_SF 39..455 CDD:273741 25/86 (29%)
RRM1_Hu 41..118 CDD:241094 23/77 (30%)
RRM2_Hu 128..206 CDD:241096
RRM3_Hu 373..449 CDD:240823
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.