DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3g1 and Elavl1

DIOPT Version :9

Sequence 1:NP_570011.1 Gene:eIF3g1 / 31243 FlyBaseID:FBgn0029629 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_034615.2 Gene:Elavl1 / 15568 MGIID:1100851 Length:326 Species:Mus musculus


Alignment Length:284 Identity:58/284 - (20%)
Similarity:107/284 - (37%) Gaps:78/284 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ETIKSSWADEVELDYGGLPPTTETVENGQKYVTEYKYNKDDKKTKVVRTYKISKQVVPKTVAKRR 69
            :|||.|:|          .|::|.:::...|::.                      :|:|:.::.
Mouse    89 KTIKVSYA----------RPSSEVIKDANLYISG----------------------LPRTMTQKD 121

  Fly    70 T---WTKFGDSKNDKPGPNSQTTMVS--------------EEIIMQFLNSKEDEKANDPL----- 112
            .   :::||...|.:...: |||.:|              ||.|..| |..:...:::|:     
Mouse   122 VEDMFSRFGRIINSRVLVD-QTTGLSRGVAFIRFDKRSEAEEAITSF-NGHKPPGSSEPITVKFA 184

  Fly   113 LDPTKNIAKCRICNGEHWSVNCPYKGTAMDTNMMEKKASAAAAAAVDAPKSGKYVPPFLKDSQKG 177
            .:|.:|                  |..|:.:.:....|...........:..::.|..: |...|
Mouse   185 ANPNQN------------------KNMALLSQLYHSPARRFGGPVHHQAQRFRFSPMGV-DHMSG 230

  Fly   178 ALGMRGRDDTAA---IRISNLSESMTEADLEELVKKIGPQSKMYLARDKNTGLCKGFAYVHFKQR 239
            ..|:....:.::   |.|.||.:...|..|.::....|..:.:.:.||.||..||||.:|.....
Mouse   231 ISGVNVPGNASSGWCIFIYNLGQDADEGILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNY 295

  Fly   240 KDAAAAIEILNGHGYDHLILSVEW 263
            ::||.||..|||:.....||.|.:
Mouse   296 EEAAMAIASLNGYRLGDKILQVSF 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3g1NP_570011.1 eIF3g 30..140 CDD:289149 19/131 (15%)
RRM <161..>269 CDD:223796 30/106 (28%)
RRM_eIF3G_like 189..265 CDD:240854 26/78 (33%)
Elavl1NP_034615.2 ELAV_HUD_SF 19..326 CDD:273741 58/284 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.