Sequence 1: | NP_570011.1 | Gene: | eIF3g1 / 31243 | FlyBaseID: | FBgn0029629 | Length: | 269 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_543022.1 | Gene: | PABPC5 / 140886 | HGNCID: | 13629 | Length: | 382 | Species: | Homo sapiens |
Alignment Length: | 202 | Identity: | 50/202 - (24%) |
---|---|---|---|
Similarity: | 85/202 - (42%) | Gaps: | 28/202 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 68 RRTWTKFGDSKNDKPGPNSQTTMVSEEIIMQFLNSKEDEKANDPLLDPTKNIAKCRICNGEHWSV 132
Fly 133 NCPYKGTAMDTNMMEKKASAAAAAA------VDAPKSGKYVPPFLKDSQKGALGMRGRDDT--AA 189
Fly 190 IRISNLSESMTEADLEELVKKIGPQSKMYLARDKNTGLCKGFAYVHFKQRKDAAAAIEILNGHGY 254
Fly 255 DHLILSV 261 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
eIF3g1 | NP_570011.1 | eIF3g | 30..140 | CDD:289149 | 16/71 (23%) |
RRM | <161..>269 | CDD:223796 | 28/103 (27%) | ||
RRM_eIF3G_like | 189..265 | CDD:240854 | 20/73 (27%) | ||
PABPC5 | NP_543022.1 | PABP-1234 | 22..>379 | CDD:130689 | 50/202 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |