DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3g1 and AgaP_AGAP009952

DIOPT Version :9

Sequence 1:NP_570011.1 Gene:eIF3g1 / 31243 FlyBaseID:FBgn0029629 Length:269 Species:Drosophila melanogaster
Sequence 2:XP_319085.4 Gene:AgaP_AGAP009952 / 1279370 VectorBaseID:AGAP009952 Length:363 Species:Anopheles gambiae


Alignment Length:231 Identity:47/231 - (20%)
Similarity:87/231 - (37%) Gaps:76/231 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 KDDKKTKVVRTYKISKQVVPKTVAKRRTWTKFGDSKN-----DKPG-----PNSQT--------- 88
            ::|.||.::..| :.:|:..:.:  |..::..|:.::     ||||     .::.|         
Mosquito    22 QEDSKTNLIVNY-LPQQMTQEEI--RSLFSSIGEVESCKLIRDKPGCVTRHAHTHTYIHLFDGCY 83

  Fly    89 TMVSEEIIMQFLNSKEDEKANDPLLDPTKNIAKCRICNGEHWSVNCPYKGTAMDTNMMEKKASAA 153
            .:..:.:...|:|.:..|.|:..:                         .|.....:..|:...:
Mosquito    84 LLTGQSLGYGFVNYQRAEDASKAI-------------------------NTLNGLRLQNKQIKVS 123

  Fly   154 AAAAVDAPKSGKYVPPFLKDSQKGALGMRGRDDTAAIRISNLSESMTEADLEELVKKIGPQSKMY 218
                            |.:.|.:...|       |.:.:|.|.::|.:||||.|   ..|..::.
Mosquito   124 ----------------FARPSSEAIKG-------ANLYVSGLPKNMLQADLEAL---FSPYGRII 162

  Fly   219 LAR---DKNTGLCKGFAYVHFKQRKDAAAAIEILNG 251
            .:|   |..|||.||..::.|.||.:|..||:.|||
Mosquito   163 TSRILCDNITGLSKGVGFIRFDQRMEAEKAIKELNG 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3g1NP_570011.1 eIF3g 30..140 CDD:289149 16/115 (14%)
RRM <161..>269 CDD:223796 29/94 (31%)
RRM_eIF3G_like 189..265 CDD:240854 25/66 (38%)
AgaP_AGAP009952XP_319085.4 ELAV_HUD_SF 24..361 CDD:273741 47/229 (21%)
RRM1_Hu 26..125 CDD:241094 17/142 (12%)
RRM2_Hu 135..213 CDD:241096 26/67 (39%)
RRM3_Hu 279..356 CDD:240823
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.