DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3g1 and AgaP_AGAP008433

DIOPT Version :9

Sequence 1:NP_570011.1 Gene:eIF3g1 / 31243 FlyBaseID:FBgn0029629 Length:269 Species:Drosophila melanogaster
Sequence 2:XP_317010.3 Gene:AgaP_AGAP008433 / 1277542 VectorBaseID:AGAP008433 Length:526 Species:Anopheles gambiae


Alignment Length:60 Identity:19/60 - (31%)
Similarity:31/60 - (51%) Gaps:0/60 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 ISNLSESMTEADLEELVKKIGPQSKMYLARDKNTGLCKGFAYVHFKQRKDAAAAIEILNG 251
            :.:|..::||..|..:.:..|....:.|..|.:||..||:.::.|....||..|:|.|||
Mosquito   273 VGSLHFNITEDMLNGIFEPFGKIDNIQLIMDADTGRSKGYGFITFHNADDAKKALEQLNG 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3g1NP_570011.1 eIF3g 30..140 CDD:289149
RRM <161..>269 CDD:223796 19/60 (32%)
RRM_eIF3G_like 189..265 CDD:240854 19/60 (32%)
AgaP_AGAP008433XP_317010.3 PRP38_assoc <40..109 CDD:289628
SF-CC1 53..511 CDD:273721 19/60 (32%)
RRM1_RBM39_like 172..244 CDD:240729
RRM2_RBM23_RBM39 271..343 CDD:240730 19/60 (32%)
RBM39linker 360..436 CDD:292157
RRM3_RBM39_like 418..502 CDD:240731
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.