DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3g1 and AgaP_AGAP002335

DIOPT Version :9

Sequence 1:NP_570011.1 Gene:eIF3g1 / 31243 FlyBaseID:FBgn0029629 Length:269 Species:Drosophila melanogaster
Sequence 2:XP_312633.5 Gene:AgaP_AGAP002335 / 1273632 VectorBaseID:AGAP002335 Length:458 Species:Anopheles gambiae


Alignment Length:184 Identity:39/184 - (21%)
Similarity:72/184 - (39%) Gaps:30/184 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 TMVSEEIIMQFLNSKEDEKANDPLLDPTKNIAKCRICNGEHWSVNCPYKGTAMDT-NMMEKKASA 152
            |.|:||::.             .|......:..|:|           .:.|::|. ..:|.....
Mosquito    17 TSVTEELLC-------------TLFSQMGTVKSCKI-----------IRETSIDPFAFIEYANHQ 57

  Fly   153 AAAAAVDAPKSGKYVPPFLKDSQKGALGMRGRDDTAA---IRISNLSESMTEADLEELVKKIGPQ 214
            :|..|:.|.....::...::.:...:.|.:.:.||:.   |.:.:||..:....|.|.....|..
Mosquito    58 SAQTALAAMNKRMFLKKEIRVNWATSAGNQPKTDTSQHHHIFVGDLSPEIDTETLREAFAPFGEI 122

  Fly   215 SKMYLARDKNTGLCKGFAYVHFKQRKDAAAAIEILNGHGYDHLILSVEWS--KP 266
            |...:.||..|...:|:|:|.|.::.:|..||.::||.......:...||  ||
Mosquito   123 SNCRIVRDPQTLKSRGYAFVSFVKKAEAENAIAMMNGQWLGSRSIRTNWSTRKP 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3g1NP_570011.1 eIF3g 30..140 CDD:289149 7/50 (14%)
RRM <161..>269 CDD:223796 26/111 (23%)
RRM_eIF3G_like 189..265 CDD:240854 21/80 (26%)
AgaP_AGAP002335XP_312633.5 RRM1_TIA1_like 10..81 CDD:240798 13/87 (15%)
RRM2_TIA1_like 97..171 CDD:240799 19/73 (26%)
RRM3_TIA1_like 206..279 CDD:240800
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.