DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3g1 and AgaP_AGAP000965

DIOPT Version :9

Sequence 1:NP_570011.1 Gene:eIF3g1 / 31243 FlyBaseID:FBgn0029629 Length:269 Species:Drosophila melanogaster
Sequence 2:XP_309157.5 Gene:AgaP_AGAP000965 / 1270460 VectorBaseID:AGAP000965 Length:340 Species:Anopheles gambiae


Alignment Length:255 Identity:61/255 - (23%)
Similarity:98/255 - (38%) Gaps:76/255 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 ETV-ENGQKYVTEYKYNKDDKKTKVVRTYKISKQVVPKTVAK---RRTWTKFGDSKNDKPGPNSQ 87
            ||| :||:.  ......::|.||.::..|      :|:|:.:   :..::..||.::.|      
Mosquito     7 ETVQQNGRS--GSIGSGQEDSKTNLIVNY------LPQTMTQEEVKSLFSSIGDVESCK------ 57

  Fly    88 TTMVSEEIIMQ-----FLNSKEDEKANDPLLDPTKNIAKCRICNGEHWSVNCPYKGTAMDTNMME 147
              ::.:::..|     |:|....|.|..                    ::| .:.|..:....: 
Mosquito    58 --LIRDKVTGQSLGYGFVNYHRPEDAEK--------------------AIN-TFNGLRLQNKTI- 98

  Fly   148 KKASAAAAAAVDAPKSGKYVPPFLKDSQKGALGMRGRDDTAAIRISNLSESMTEADLEELVKKIG 212
             |.|.|      .|.|         |:.||          |.:.:|.||:|||:.|||.|....|
Mosquito    99 -KVSFA------RPSS---------DAIKG----------ANLYVSGLSKSMTQQDLENLFNAYG 137

  Fly   213 PQSKMYLARDKNTGLCKGFAYVHFKQRKDAAAAIEILNG---HGYDHLILSVEWSKPQNN 269
            ......:..|..|||.||..::.|.||.:|..||:.|||   .|....|.....:.|.||
Mosquito   138 QIITSRILCDNITGLSKGVGFIRFDQRSEAERAIQQLNGTTPKGASEPITVKFANNPSNN 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3g1NP_570011.1 eIF3g 30..140 CDD:289149 18/117 (15%)
RRM <161..>269 CDD:223796 35/110 (32%)
RRM_eIF3G_like 189..265 CDD:240854 28/78 (36%)
AgaP_AGAP000965XP_309157.5 ELAV_HUD_SF 24..336 CDD:273741 56/236 (24%)
RRM1_Hu 26..103 CDD:241094 17/113 (15%)
RRM2_Hu 113..191 CDD:241096 29/77 (38%)
RRM3_Hu 254..331 CDD:240823
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.