DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3g1 and AgaP_AGAP006798

DIOPT Version :9

Sequence 1:NP_570011.1 Gene:eIF3g1 / 31243 FlyBaseID:FBgn0029629 Length:269 Species:Drosophila melanogaster
Sequence 2:XP_308949.4 Gene:AgaP_AGAP006798 / 1270267 VectorBaseID:AGAP006798 Length:271 Species:Anopheles gambiae


Alignment Length:108 Identity:31/108 - (28%)
Similarity:49/108 - (45%) Gaps:7/108 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 PPFLKDSQKGALGMRGRDDTAA----IRISNLSESMTEADLEELVKKIGPQSKMYLARDKNTGLC 228
            ||....:..||........:.:    :.:.|||...|||:|.:...|.||..|..:..|..||..
Mosquito    72 PPASSSASGGAHECSSHSGSTSGKVVLAVFNLSVYTTEAELYDTFSKFGPLRKTTVVLDAKTGRS 136

  Fly   229 KGFAYVHFKQRKDAAAAIEILNGHGYDHLILSVEWS---KPQN 268
            :||.:|:|:..:||..|.:..||.......:.|::|   ||.:
Mosquito   137 RGFGFVYFESAEDAKVAHDQANGIEIGDRRIRVDFSATNKPHD 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3g1NP_570011.1 eIF3g 30..140 CDD:289149
RRM <161..>269 CDD:223796 31/108 (29%)
RRM_eIF3G_like 189..265 CDD:240854 25/82 (30%)
AgaP_AGAP006798XP_308949.4 RRM <71..>172 CDD:223796 28/99 (28%)
RRM_TRA2 97..174 CDD:240809 25/76 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.