DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment eIF3g1 and RAVER1

DIOPT Version :9

Sequence 1:	NP_570011.1	Gene:	eIF3g1 / 31243	FlyBaseID:	FBgn0029629	Length:	269	Species:	Drosophila melanogaster
Sequence 2:	NP_597709.3	Gene:	RAVER1 / 125950	HGNCID:	30296	Length:	739	Species:	Homo sapiens

Alignment Length:	129	Identity:	35/129 - (27%)
Similarity:	60/129 - (46%)	Gaps:	12/129 - (9%)

- Green bases have known domain annotations that are detailed below.

  Fly   136 YKGTAMDTNMMEKKASAAAAAAVDAPKSGKYVPPFLKDSQKGALGMRGRDDTAAIRISNLSESMT 200
            |||||..|.:..::|.||..|         :....|::.:   |.::.:...|.:.::||..|:|
Human    92 YKGTAFVTLLNGEQAEAAINA---------FHQSRLRERE---LSVQLQPTDALLCVANLPPSLT 144

  Fly   201 EADLEELVKKIGPQSKMYLARDKNTGLCKGFAYVHFKQRKDAAAAIEILNGHGYDHLILSVEWS 264
            :...||||:..|...:.:|...:.||..||:.:..:.::..||.|...|.|.......|.|.|:
Human   145 QQQFEELVRPFGSLERCFLVYSERTGQSKGYGFAEYMKKDSAARAKSDLLGKPLGPRTLYVHWT 208

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
eIF3g1	NP_570011.1	eIF3g	30..140	CDD:289149	3/3 (100%)
		RRM	<161..>269	CDD:223796	25/104 (24%)
		RRM_eIF3G_like	189..265	CDD:240854	22/76 (29%)
RAVER1	NP_597709.3	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..41
		Nuclear localization signal. /evidence=ECO:0000255	45..60
		RRM1_RAVER1	59..129	CDD:241107	12/48 (25%)
		RRM2_RAVER1	133..209	CDD:241109	22/76 (29%)
		RRM3_RAVER1	219..306	CDD:241111
		Interaction with PTBP1. /evidence=ECO:0000250	307..395
		Atrophin-1	<364..635	CDD:331285
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	391..474
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910