DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klp3A and CG32318

DIOPT Version :9

Sequence 1:NP_001284830.1 Gene:Klp3A / 31240 FlyBaseID:FBgn0011606 Length:1212 Species:Drosophila melanogaster
Sequence 2:NP_995952.1 Gene:CG32318 / 2768976 FlyBaseID:FBgn0052318 Length:164 Species:Drosophila melanogaster


Alignment Length:91 Identity:30/91 - (32%)
Similarity:49/91 - (53%) Gaps:10/91 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VAVALRVRPLVQSELDRGCRIAVERSADGAPQVTVNRN-------ESYTYNYVFDIDDSQKDLFE 66
            :.|.:|||||  :..:|..|.|......| |:..|.|:       :.:|::..|..:..|.|::.
  Fly    20 IQVYVRVRPL--NSRERCIRSAEVVDVVG-PREVVTRHTLDSKLTKKFTFDRSFGPESKQCDVYS 81

  Fly    67 TCVQAKVKKLLNGYNVTILAYGQTGS 92
            ..|...::::|||||.|:.||||||:
  Fly    82 VVVSPLIEEVLNGYNCTVFAYGQTGN 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klp3ANP_001284830.1 KISc_KIF4 7..336 CDD:276823 30/91 (33%)
Kinesin 14..335 CDD:278646 29/86 (34%)
Smc <396..>994 CDD:224117
FlaC 522..633 CDD:225888
TCR 1075..1110 CDD:281618
CG32318NP_995952.1 Motor_domain 17..>106 CDD:277568 28/88 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437909
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.