DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13760 and GC1

DIOPT Version :9

Sequence 1:NP_570010.3 Gene:CG13760 / 31237 FlyBaseID:FBgn0040375 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_568159.1 Gene:GC1 / 830478 AraportID:AT5G05930 Length:274 Species:Arabidopsis thaliana


Alignment Length:235 Identity:72/235 - (30%)
Similarity:119/235 - (50%) Gaps:26/235 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GLPPSKHYNLTHYQQRYNWDCGLSCIIMILSAQQ-REQLLGNFDAVCGEEGFGSSTWTIDLCYLL 66
            |||.|.|.::.|..|..:|||||:|::|:|.|.. ....|.:...:|..    :|.||:||.|||
plant    50 GLPSSSHMDVPHVHQLASWDCGLACVLMVLRASGIASCTLEDLAEICST----NSIWTVDLAYLL 110

  Fly    67 MRYQVRHEYFTQTLGIDPNYAQHTYYSKIIDKDERRVTRKFKDARAHGLRVEQRTVDMEVILRHL 131
            .::.|...|:|.|.|.:|||:...:|.:.:.:|..||...|:.|...|:.::.|:|.:       
plant   111 QKFCVEFSYYTITFGANPNYSIEEFYKEQLPEDLVRVDLLFRKAHESGIIIQCRSVSI------- 168

  Fly   132 ARHGPVILLTNASLLTCEVCKRNVLEKFGCFHIPCIAQNTRLHGPKR-YAGHYVVLCGYDMAAQK 195
              |....||.:.:.:...:..::.|.|.....:..    :.||.... |.|||||:||||....:
plant   169 --HEISCLLLSGNYIAIALVDQDKLSKSWLEEVLV----SGLHSSNSCYTGHYVVICGYDAVRDE 227

  Fly   196 LFYHNP---EVHDGHICRCLIESMDTARRAYGTDEDIIFI 232
            ....:|   ::|:....:||    :.||:::|||||::.|
plant   228 FEIRDPASSKIHERISSKCL----ENARKSFGTDEDLLLI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13760NP_570010.3 Guanylate_cyc_2 12..232 CDD:286819 66/224 (29%)
GC1NP_568159.1 Guanylate_cyc_2 60..263 CDD:401652 66/223 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 108 1.000 Domainoid score I2164
eggNOG 1 0.900 - - E1_KOG4621
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H57149
Inparanoid 1 1.050 119 1.000 Inparanoid score I1996
OMA 1 1.010 - - QHG59989
OrthoDB 1 1.010 - - D1348354at2759
OrthoFinder 1 1.000 - - FOG0007340
OrthoInspector 1 1.000 - - oto2972
orthoMCL 1 0.900 - - OOG6_106070
Panther 1 1.100 - - LDO PTHR31400
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5456
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.930

Return to query results.
Submit another query.