DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13760 and Gucd1

DIOPT Version :9

Sequence 1:NP_570010.3 Gene:CG13760 / 31237 FlyBaseID:FBgn0040375 Length:240 Species:Drosophila melanogaster
Sequence 2:XP_038955000.1 Gene:Gucd1 / 687713 RGDID:1597571 Length:311 Species:Rattus norvegicus


Alignment Length:229 Identity:90/229 - (39%)
Similarity:127/229 - (55%) Gaps:28/229 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 QQRYNWDCGLSCIIMILSAQQREQLLG-----NFDAVCGEEGFGSSTWTIDLCYLLMRYQVRHEY 75
            ||.|:|||||:|..|:|      :.||     .|:....|.....|.|||||.||:..:.|||.:
  Rat    97 QQLYHWDCGLACSRMVL------RYLGQLDDREFENALQELQLTRSIWTIDLAYLMRHFGVRHRF 155

  Fly    76 FTQTLGIDPNYAQHTYYSKIIDKDERRVTRKFKDARAHGLRVEQRTVDMEVILRHLARHGPVILL 140
            .|||||:|..|...::|.|..|.:|.||.:.|..|:|..::||:.||.::.|..|||:....|:|
  Rat   156 CTQTLGVDKGYKNQSFYRKHFDTEETRVNQLFAQAKACKVQVEKCTVSVQDIQAHLAQGHVAIVL 220

  Fly   141 TNASLLTCEVCKRNVLEKFGCFHIP------CIAQNTRLHGPKRYAGHYVVLCGYDMAAQKLFYH 199
            .|:.:|.||:|...|  |:.|| .|      |.|.:        |.||::||.||:.|...:||:
  Rat   221 VNSGVLHCELCSSPV--KYCCF-TPRGHRCFCRAPD--------YQGHFIVLRGYNRATGCIFYN 274

  Fly   200 NPEVHDGHICRCLIESMDTARRAYGTDEDIIFIY 233
            ||...|..:|...|.:.:.||.:|||||||:|:|
  Rat   275 NPAYADPGMCSTSISNFEEARTSYGTDEDILFVY 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13760NP_570010.3 Guanylate_cyc_2 12..232 CDD:286819 88/226 (39%)
Gucd1XP_038955000.1 Guanylate_cyc_2 94..307 CDD:401652 88/226 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334837
Domainoid 1 1.000 91 1.000 Domainoid score I7540
eggNOG 1 0.900 - - E1_KOG4621
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H57149
Inparanoid 1 1.050 94 1.000 Inparanoid score I4979
OMA 1 1.010 - - QHG59989
OrthoDB 1 1.010 - - D1348354at2759
OrthoFinder 1 1.000 - - FOG0007340
OrthoInspector 1 1.000 - - oto95545
orthoMCL 1 0.900 - - OOG6_106070
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5456
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1413.710

Return to query results.
Submit another query.