DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13760 and gucd1

DIOPT Version :9

Sequence 1:NP_570010.3 Gene:CG13760 / 31237 FlyBaseID:FBgn0040375 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_001070630.1 Gene:gucd1 / 564677 ZFINID:ZDB-GENE-060929-872 Length:226 Species:Danio rerio


Alignment Length:228 Identity:88/228 - (38%)
Similarity:128/228 - (56%) Gaps:15/228 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 NLTHYQQRYNWDCGLSCIIMILS----AQQREQLLGNFDAVCGEEGFGSSTWTIDLCYLLMRYQV 71
            |:...:|.|:|||||:|..|:|.    ..:.|     |...|.:..|..|.|||||.||:.:..|
Zfish     8 NVPVIRQLYHWDCGLACSRMVLEYLNPVSEEE-----FQRACMDLEFTESVWTIDLAYLMCKLGV 67

  Fly    72 RHEYFTQTLGIDPNYAQHTYYSKIIDKDERRVTRKFKDARAHGLRVEQRTVDMEVILRHLARHGP 136
            ||.:.|||||:|..:...::|.|..|.:|.||...|..|.:.|:.|::.:|.::.|..||.:...
Zfish    68 RHCFCTQTLGVDKGFRNQSFYKKHFDTEEDRVNELFLKAESKGVLVKKCSVTVQEIQSHLEQGHV 132

  Fly   137 VILLTNASLLTCEVCKRNVLEKFGCFHIPCIAQNTRLHGPKRYAGHYVVLCGYDMAAQKLFYHNP 201
            .|:|.||.||.||:|...|  |:.|| :| :.|......|. |.||:||:||::.....:||:||
Zfish   133 AIVLVNAVLLVCELCSTPV--KYCCF-LP-VGQKCFCRKPD-YQGHFVVVCGFNRKTSSIFYNNP 192

  Fly   202 EVHDGHICRCLIESMDTARRAYGTDEDIIFIYE 234
            ...| .:|.....:.:.|||:|||||||:|||:
Zfish   193 AYSD-RVCCTSFSNFEEARRSYGTDEDILFIYK 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13760NP_570010.3 Guanylate_cyc_2 12..232 CDD:286819 84/223 (38%)
gucd1NP_001070630.1 Guanylate_cyc_2 9..222 CDD:286819 84/223 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574077
Domainoid 1 1.000 153 1.000 Domainoid score I4269
eggNOG 1 0.900 - - E1_KOG4621
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H57149
Inparanoid 1 1.050 158 1.000 Inparanoid score I4242
OMA 1 1.010 - - QHG59989
OrthoDB 1 1.010 - - D1348354at2759
OrthoFinder 1 1.000 - - FOG0007340
OrthoInspector 1 1.000 - - oto41421
orthoMCL 1 0.900 - - OOG6_106070
Panther 1 1.100 - - LDO PTHR31400
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5856
SonicParanoid 1 1.000 - - X5456
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.