DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AANATL7 and CG31248

DIOPT Version :9

Sequence 1:NP_001188542.1 Gene:AANATL7 / 31236 FlyBaseID:FBgn0040376 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001262333.1 Gene:CG31248 / 40853 FlyBaseID:FBgn0051248 Length:251 Species:Drosophila melanogaster


Alignment Length:229 Identity:49/229 - (21%)
Similarity:92/229 - (40%) Gaps:48/229 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EYKMIAPEHSEQVMEHLRRNFFADEPLNKAAGLCQNGSSCPALEAHCAEAIQHRMSV------MA 60
            |.:.:.....|:.::.|..:||.:|            |.|.|.|.:..|..|.|:.:      .|
  Fly    18 EVRSVTHSDLEEALDVLDGSFFLNE------------SVCVACEINLPENRQARLDLRELCRKTA 70

  Fly    61 VD-----AKEKDTLKIVGVVLNGIL---KPGDTAKALSKLDCNDDA---DFRKIFDLLHRHNLKH 114
            :|     .||.||.::|.|..|.|.   .||:....|...  |::.   ..|::.|.:...:.:.
  Fly    71 LDGVSLLVKEADTGRVVSVSFNKIQYAPPPGEDHFFLKFR--NEEVKSPQARRLMDFMIEVDGRI 133

  Fly   115 NLFEHFDVDCMFDVRILSVDSCYRGQGIANELVKRSVAVAKK--NGFRLLKADA----------- 166
            ::...|::.|..::..|:....:...|:...|.:.::.:.|:  .|..|...|.           
  Fly   134 DVCAMFNMVCFCELMFLATLPSHERLGLGRSLSQFTIELTKELAEGKGLEDIDDKLRSKRPAAVT 198

  Fly   167 ---TGIFSQKIFRSHGFEVFSEQPYSKYTDENGK 197
               |..||||:.::..|:|.:...||:: :..||
  Fly   199 ALWTSRFSQKVGKATDFKVINTVSYSEF-EYKGK 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AANATL7NP_001188542.1 NAT_SF <128..187 CDD:302625 14/74 (19%)
CG31248NP_001262333.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435038
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20905
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.