DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AANATL7 and AANAT1

DIOPT Version :9

Sequence 1:NP_001188542.1 Gene:AANATL7 / 31236 FlyBaseID:FBgn0040376 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_995934.1 Gene:AANAT1 / 37867 FlyBaseID:FBgn0019643 Length:275 Species:Drosophila melanogaster


Alignment Length:218 Identity:68/218 - (31%)
Similarity:112/218 - (51%) Gaps:17/218 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KMIAPEHSEQVMEHLRRNFFADEPLNKAAGLCQNGSSCPALEAHCAEAIQHRMSVMAVDAKEKDT 68
            ::|.||..|.|:..|:..||.|||||....|    ..|..||.:..:.:....|..||:.|.   
  Fly    60 ELIQPEDGEAVIAMLKTFFFKDEPLNTFLDL----GECKELEKYSLKPLPDNCSYKAVNKKG--- 117

  Fly    69 LKIVGVVLNGILK---PGDTAKALSKLDCNDDADFRKIFDLLHRHNLKHNLFEHF-DVDCMFDVR 129
             :|:||.|||:::   |.|..:..:  |..:...|:||..|:.....:.|:|:.: |.:.:.|.:
  Fly   118 -EIIGVFLNGLMRRPSPDDVPEKAA--DSCEHPKFKKILSLMDHVEEQFNIFDVYPDEELILDGK 179

  Fly   130 ILSVDSCYRGQGIANELVKRSVAVAKKNGFRLLKADATGIFSQKIFRSHGF-EVFSEQPYSKYTD 193
            |||||:.|||.|||..|.:|:....::||..:.....:..:|.::....|| |||..| ::.|..
  Fly   180 ILSVDTNYRGLGIAGRLTERAYEYMRENGINVYHVLCSSHYSARVMEKLGFHEVFRMQ-FADYKP 243

  Fly   194 ENGKVILPVEAPHIKLQQLYKAI 216
            : |:|:....|||:.:|.:.|.:
  Fly   244 Q-GEVVFKPAAPHVGIQVMAKEV 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AANATL7NP_001188542.1 NAT_SF <128..187 CDD:302625 21/59 (36%)
AANAT1NP_995934.1 RimI <168..235 CDD:223532 22/66 (33%)
NAT_SF <183..227 CDD:302625 13/43 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435032
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I4040
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1185856at2759
OrthoFinder 1 1.000 - - FOG0012700
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20905
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
66.000

Return to query results.
Submit another query.