DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AANATL7 and AANATL4

DIOPT Version :9

Sequence 1:NP_001188542.1 Gene:AANATL7 / 31236 FlyBaseID:FBgn0040376 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_611406.1 Gene:AANATL4 / 37213 FlyBaseID:FBgn0034429 Length:224 Species:Drosophila melanogaster


Alignment Length:209 Identity:60/209 - (28%)
Similarity:105/209 - (50%) Gaps:4/209 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KMIAPEHSEQVMEHLRRNFFADEPLNKAAGLCQNGSSCPALEAHCAEAIQHRMSVMAVDAKEKDT 68
            :::.||...||..::...::..|||.:::|...:..:....:|.....|....|::|:|  |.|.
  Fly    12 RIMRPEDYAQVKAYMEAEYYTSEPLCQSSGEPVHQQNEEINDAFNQSIIAEGTSLLALD--ENDG 74

  Fly    69 LKIVGVVLNGILKPGD-TAKALS-KLDCNDDADFRKIFDLLHRHNLKHNLFEHFDVDCMFDVRIL 131
            .:|||:||.....|.: .|..|: ||:..:|..:.:::.||.:...:.||||.:|:.......:.
  Fly    75 GRIVGLVLACASYPDNVNAGTLNLKLENVEDNAWGRMYHLLMKAKREVNLFERYDIPKALYSHVT 139

  Fly   132 SVDSCYRGQGIANELVKRSVAVAKKNGFRLLKADATGIFSQKIFRSHGFEVFSEQPYSKYTDENG 196
            ||.|..||:|:.:.|....:.:.:.|||.|:.|..|..:|.:...:.|.|......|:.|.|:.|
  Fly   140 SVASWKRGKGLGSRLAATLMELGRSNGFPLMMAFCTSFYSARQKGALGMECIYSIDYADYKDDEG 204

  Fly   197 KVILPVEAPHIKLQ 210
            :||....|||.||:
  Fly   205 RVIFTPAAPHTKLR 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AANATL7NP_001188542.1 NAT_SF <128..187 CDD:302625 16/58 (28%)
AANATL4NP_611406.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435030
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I4040
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1185856at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20905
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
55.000

Return to query results.
Submit another query.