DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AANATL7 and AANATL2

DIOPT Version :9

Sequence 1:NP_001188542.1 Gene:AANATL7 / 31236 FlyBaseID:FBgn0040376 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001285667.1 Gene:AANATL2 / 33874 FlyBaseID:FBgn0031791 Length:216 Species:Drosophila melanogaster


Alignment Length:205 Identity:53/205 - (25%)
Similarity:96/205 - (46%) Gaps:23/205 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 EQVMEHLRRNFFADEPLNKAAGLCQNGSSCPALEAHCAEAIQHR------MSVMAVDAKEKDTLK 70
            |:|...|..:||..|||     :..........|...|||..||      :|::|||.:     :
  Fly    15 EEVEAFLAVHFFKQEPL-----MLIPQEDPKQSEVSSAEAELHRSLIPQDLSLVAVDGE-----R 69

  Fly    71 IVGVVLNGILKPGDTAKALSKLDCNDDADFRKIFDLLHRH----NLKHNLFEHFDVDCMFDVRIL 131
            ||||||.|.|.|.|..:...:.   :..:...:.|.:|:.    ..:.|:|:|:.|:....:.:|
  Fly    70 IVGVVLAGELVPEDLEREYQEA---EQKEITCLLDKIHKFLAGIERQANIFKHYGVERALYLYML 131

  Fly   132 SVDSCYRGQGIANELVKRSVAVAKKNGFRLLKADATGIFSQKIFRSHGFEVFSEQPYSKYTDENG 196
            .||...|.|.:...||:.::.:.::.||.::.:..:...|:::..:...|....:.|:.|.||:|
  Fly   132 GVDVSIRRQRVGTRLVEATIELGRQRGFPVVTSTCSNQNSKRLMTALNMECILTKDYADYKDEHG 196

  Fly   197 KVILPVEAPH 206
            :::|....||
  Fly   197 EIVLRASEPH 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AANATL7NP_001188542.1 NAT_SF <128..187 CDD:302625 11/58 (19%)
AANATL2NP_001285667.1 NAT_SF 114..163 CDD:173926 13/48 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435029
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1185856at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20905
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.