DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AANATL7 and CG31493

DIOPT Version :9

Sequence 1:NP_001188542.1 Gene:AANATL7 / 31236 FlyBaseID:FBgn0040376 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_731135.2 Gene:CG31493 / 318765 FlyBaseID:FBgn0051493 Length:246 Species:Drosophila melanogaster


Alignment Length:117 Identity:27/117 - (23%)
Similarity:52/117 - (44%) Gaps:7/117 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PALEAHCAEAIQHRMS-VMAVDAKEKDTLKIVGVVLNGILKPGDTAKALSKLD-CND--DADFRK 102
            |...|...:.|:|.:| .::...:..::.:||..:.|.|.   :|.:..|..| |..  ..:..|
  Fly    49 PLAIAELGKLIRHIISRGISFAIRHVESGRIVAAIANIIF---NTKRKTSYYDICAQIKSPNMIK 110

  Fly   103 IFDLLHRHNLKHNLFEHFDVDCMFDVRILSVDSCYRGQGIANELVKRSVAVA 154
            ..:|....:...|:.||..||...||..::....:|.:|:.:.|.::|:..|
  Fly   111 YMELWDAVDASFNVNEHCQVDSTGDVEYMATLPEFRRRGLGHILCQQSIQFA 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AANATL7NP_001188542.1 NAT_SF <128..187 CDD:302625 6/27 (22%)
CG31493NP_731135.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435047
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20905
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.