DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AANATL7 and AgmNAT

DIOPT Version :9

Sequence 1:NP_001188542.1 Gene:AANATL7 / 31236 FlyBaseID:FBgn0040376 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_572268.1 Gene:AgmNAT / 31512 FlyBaseID:FBgn0029813 Length:216 Species:Drosophila melanogaster


Alignment Length:213 Identity:46/213 - (21%)
Similarity:82/213 - (38%) Gaps:34/213 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SEQVMEHLRRNFFADEPLNKAAGLCQNGSSCPALEA-------------HCAEAIQHRMSVMAVD 62
            :||:|..|..:::.:|||..       |:..|..||             .|..|:.....|.||.
  Fly    19 TEQLMTFLLAHYYPEEPLTA-------GTHPPEPEAADKEFLLSNVPFGTCFVALHEGRIVAAVV 76

  Fly    63 AKEKDTLKIVGVVLNGILKPGDTAKALSKLDCNDDADFRKIFDLLHRHNLKHNLFEHFDVDCMFD 127
            |..||:           .:|...|:...|.   ....:..|..||.......::...|.|.....
  Fly    77 AGPKDS-----------HEPEHMAEEARKY---AGGKWGSILHLLSAVETATDVCRRFSVPSCLH 127

  Fly   128 VRILSVDSCYRGQGIANELVKRSVAVAKKNGFRLLKADATGIFSQKIFRSHGFEVFSEQPYSKYT 192
            |..|.||...||:.:...|::......:..|.:|:..|.|.::|.::.:..|:::.:...|..:.
  Fly   128 VHALGVDPQLRGRNLGGRLMETVAQRGRDLGHQLVSVDCTSVYSARLVQRLGYQLINTLRYVDHL 192

  Fly   193 DENGKVILPVEAPHIKLQ 210
            |.:|:.::....||..:|
  Fly   193 DASGQQVIRPPPPHESVQ 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AANATL7NP_001188542.1 NAT_SF <128..187 CDD:302625 13/58 (22%)
AgmNATNP_572268.1 Acetyltransf_1 33..180 CDD:306954 35/167 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435033
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1185856at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20905
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.