DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AANATL7 and anat-1

DIOPT Version :9

Sequence 1:NP_001188542.1 Gene:AANATL7 / 31236 FlyBaseID:FBgn0040376 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001076662.1 Gene:anat-1 / 177439 WormBaseID:WBGene00015938 Length:285 Species:Caenorhabditis elegans


Alignment Length:174 Identity:36/174 - (20%)
Similarity:62/174 - (35%) Gaps:41/174 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 AEAIQHRMSVMAVDAKEKDTLKIVGVVLNGILKPGDTAKALSKLDCNDDADFRKIFDLLHRHNLK 113
            |....:|........||.:..:||..:::..   ..|...|:.|..:||    ||          
 Worm    54 ANMTANRQQYQVESVKESNLEEIVQFLIDNF---AQTEAILASLKIDDD----KI---------- 101

  Fly   114 HNLFEHFDVDCMFDVRILSVDSCYRGQGIANELVKRSVAVAKKNGFRLLKADATGIFSQKIFRSH 178
                      |:.::.::..|........::..|.|.|...:.:|..|  |..|.||.::|.|..
 Worm   102 ----------CLKELTVMLRDLVQDSLQCSSTCVIRDVTTRQIDGIAL--ACKTSIFDKQIDRLC 154

  Fly   179 GFEVFSEQ------PYSKYTDENGKVILPVEAPHIKLQQLYKAI 216
            .:| |.||      .:.||......|:.     ::...:|||.:
 Worm   155 AYE-FREQRVRDAVEFLKYVFNKLDVMY-----YLNEHRLYKPV 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AANATL7NP_001188542.1 NAT_SF <128..187 CDD:302625 16/64 (25%)
anat-1NP_001076662.1 NAT_SF <192..221 CDD:173926 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20905
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.