DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AANATL7 and R05H10.1

DIOPT Version :9

Sequence 1:NP_001188542.1 Gene:AANATL7 / 31236 FlyBaseID:FBgn0040376 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_497076.1 Gene:R05H10.1 / 175144 WormBaseID:WBGene00011042 Length:250 Species:Caenorhabditis elegans


Alignment Length:225 Identity:45/225 - (20%)
Similarity:97/225 - (43%) Gaps:17/225 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 YKMIAPEHSEQVMEHLRRNFFADEPLNKAAGLCQNGSSCPALEAHCAEAIQHRMSVMAVDAKEKD 67
            |:.......:::::.|..:|:.:||..:|:.:... ...|........:::..:|.:..   .:|
 Worm     7 YRTAEKSDFDRILKFLAEHFYHEEPSIRASKIALE-EWLPIFGEMTTSSLKLPISTVVT---TED 67

  Fly    68 TLKIVGVVLNGILKPGDTAKALSKLDCNDDADFRKIFDLLHR--------HNLKHNLFEHFDVDC 124
            ...||.|:||.:....:..:.:...:...|.|.....:.|.|        |:...||... ||:.
 Worm    68 GENIVAVLLNSMWSREEDEERMKHGNGKGDHDTSGYSEALQRFMTIVQKCHDEFWNLAPS-DVNL 131

  Fly   125 MFDVRILSVDSCYRGQGIANELVKRSVAVAKKNGFRLLKADATGIFSQKIFRSHGFEVFSEQPYS 189
            :....|.||...::.||||.:::.|:::.|:.:....:.:..:...:|.:...:||:...|.|||
 Worm   132 VVYREISSVGKPWQRQGIATKMLSRNMSAARLHNVDGIVSATSSFANQTLLAKNGFQCLKEFPYS 196

  Fly   190 KYTDENG-KVILPVEAPH---IKLQQLYKA 215
            .....|| |::...:..|   |..:::.|:
 Worm   197 GIVSSNGDKLVETDDGSHGMRINFKRIEKS 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AANATL7NP_001188542.1 NAT_SF <128..187 CDD:302625 13/58 (22%)
R05H10.1NP_497076.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 57 1.000 Domainoid score I7221
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I4040
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1185856at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20905
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.070

Return to query results.
Submit another query.