DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha36-3 and Vha36-2

DIOPT Version :9

Sequence 1:NP_001284828.1 Gene:Vha36-3 / 31235 FlyBaseID:FBgn0040377 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_610753.1 Gene:Vha36-2 / 36328 FlyBaseID:FBgn0033706 Length:373 Species:Drosophila melanogaster


Alignment Length:239 Identity:91/239 - (38%)
Similarity:137/239 - (57%) Gaps:2/239 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAAKDRLPIFPSRGAQTLMKSRLAGATKGHGLLKKKADALQMRFRLILGKIIETKTLMG-QVMKE 64
            ||.:|.|||||||....:||.|:..|.:|.||||:|.||:.|:.| .|.:|...:.:.| :.|:.
  Fly     1 MAKRDILPIFPSRANSVIMKQRVLAARRGVGLLKRKRDAIDMKLR-ELRRIRFDQDMHGDEAMRN 64

  Fly    65 AAFSLAEVKFTTGDINQIVLQNVTKAQIKIRTKKDNVAGVTLPIFEPYTDGVDTYELAGLARGGQ 129
            |.||:|:......|....::.....|.:.:|..:..:.||.|...|..|.||..:.||||:.||.
  Fly    65 AIFSMAKANLLGADFKPQMVSRSHVATVSLRRTEIKIVGVKLNTLELETKGVGAFPLAGLSCGGM 129

  Fly   130 QLAKLKKNYQSAVRLLVQLASLQTSFVTLDDVIKVTNRRVNAIEHVIIPRINRTIEYIISELDEL 194
            |:::::.:|..|::.||:.|||:.....|:.....||.||||:|||:||.:..|..||..||:|.
  Fly   130 QVSRIRDSYTKALKALVEFASLEYQVRMLEAASLQTNMRVNALEHVVIPILQNTYNYICGELEEF 194

  Fly   195 EREEFYRLKKIQDKKREARKASDKLRAEQRLLGQMAEAQEVQNI 238
            |||:|||||:.|.|:.||:.|..:|...:.:..:..|....:||
  Fly   195 EREDFYRLKRSQAKQLEAKMAFTELIKTKNMTDEELETYIKRNI 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha36-3NP_001284828.1 ATP-synt_D 17..206 CDD:280060 72/189 (38%)
Vha36-2NP_610753.1 ATP-synt_D 18..206 CDD:280060 72/188 (38%)
PEHE <253..>294 CDD:291924
DUF4628 <281..>373 CDD:292069
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470075
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S324
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1313938at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101069
Panther 1 1.100 - - P PTHR11671
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.800

Return to query results.
Submit another query.