DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha36-3 and Atp6v1d

DIOPT Version :9

Sequence 1:NP_001284828.1 Gene:Vha36-3 / 31235 FlyBaseID:FBgn0040377 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_955418.1 Gene:Atp6v1d / 299159 RGDID:735119 Length:247 Species:Rattus norvegicus


Alignment Length:249 Identity:172/249 - (69%)
Similarity:201/249 - (80%) Gaps:3/249 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAAKDRLPIFPSRGAQTLMKSRLAGATKGHGLLKKKADALQMRFRLILGKIIETKTLMGQVMKEA 65
            |:.|||:.|||||.|||:||:||.||..|..|||||:|||.:|||.||.||||||.|||:||:||
  Rat     1 MSGKDRIEIFPSRMAQTIMKARLKGAQTGRNLLKKKSDALTLRFRQILKKIIETKMLMGEVMREA 65

  Fly    66 AFSLAEVKFTTGDINQIVLQNVTKAQIKIRTKKDNVAGVTLPIFEPYTDGVDTYELAGLARGGQQ 130
            ||||||.|||.||.:..|:|||.|||:|||.|||||||||||:||.|.:|.|:|||.||||||:|
  Rat    66 AFSLAEAKFTAGDFSTTVIQNVNKAQVKIRAKKDNVAGVTLPVFEHYHEGTDSYELTGLARGGEQ 130

  Fly   131 LAKLKKNYQSAVRLLVQLASLQTSFVTLDDVIKVTNRRVNAIEHVIIPRINRTIEYIISELDELE 195
            |||||:||..||.|||:||||||||||||:.||:||||||||||||||||.||:.|||:||||.|
  Rat   131 LAKLKRNYAKAVELLVELASLQTSFVTLDEAIKITNRRVNAIEHVIIPRIERTLAYIITELDERE 195

  Fly   196 REEFYRLKKIQDKKREARKASDKLRAEQRLLGQMAEAQEVQNILDEDGDEDLLF 249
            |||||||||||:||:..::.|:|....:|..|   |..|..|:|.|:.||||||
  Rat   196 REEFYRLKKIQEKKKIIKEKSEKDLERRRAAG---EVMEPANLLAEEKDEDLLF 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha36-3NP_001284828.1 ATP-synt_D 17..206 CDD:280060 142/188 (76%)
Atp6v1dNP_955418.1 ATP-synt_D 17..202 CDD:396399 138/184 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353567
Domainoid 1 1.000 296 1.000 Domainoid score I1419
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 337 1.000 Inparanoid score I2314
OMA 1 1.010 - - QHG60833
OrthoDB 1 1.010 - - D1313938at2759
OrthoFinder 1 1.000 - - FOG0003389
OrthoInspector 1 1.000 - - otm44998
orthoMCL 1 0.900 - - OOG6_101069
Panther 1 1.100 - - O PTHR11671
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2286
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.910

Return to query results.
Submit another query.