DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdfr and VIPR1

DIOPT Version :9

Sequence 1:NP_001245501.1 Gene:Pdfr / 31234 FlyBaseID:FBgn0260753 Length:738 Species:Drosophila melanogaster
Sequence 2:NP_004615.2 Gene:VIPR1 / 7433 HGNCID:12694 Length:457 Species:Homo sapiens


Alignment Length:492 Identity:142/492 - (28%)
Similarity:206/492 - (41%) Gaps:94/492 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 APWNLTLASA-----------AATNFENC---------------SALFVNYTLPQTGLYCNWTWD 221
            |.|...||.|           ||...|.|               .|...|.|:.     |:..||
Human     9 ARWLCVLAGALAWALGPAGGQAARLQEECDYVQMIEVQHKQCLEEAQLENETIG-----CSKMWD 68

  Fly   222 TLLCWPPTPAGVLARMNCPGGFHGVDTRKFAIRKCELDGRWGSRPNATEVNPPGWTDYGPCYKPE 286
            .|.|||.||.|.:..:.||..|     :.|:    .:.||..||....|    |||...|...|.
Human    69 NLTCWPATPRGQVVVLACPLIF-----KLFS----SIQGRNVSRSCTDE----GWTHLEPGPYPI 120

  Fly   287 IIRLMQQMGSKDFDAYIDIARRTRTLEIVGLCLSLFALIVSLLIFCTFRSLRNNRTKIHKNLFVA 351
            ...|..:..|.| :.........:|...:|..|||..|:|:..|...||.|...|..||.:||::
Human   121 ACGLDDKAASLD-EQQTMFYGSVKTGYTIGYGLSLATLLVATAILSLFRKLHCTRNYIHMHLFIS 184

  Fly   352 MVLQVIIRLTLYLDQFRRGNKEAATNTSLSVIENTPYLCEASYVLLEYARTAMFMWMFIEGLYLH 416
            .:|:........|..|..|..:..:..|:.        |:|:.|..:|...|.|.|:.:|||||:
Human   185 FILRAAAVFIKDLALFDSGESDQCSEGSVG--------CKAAMVFFQYCVMANFFWLLVEGLYLY 241

  Fly   417 NMVTVAVFQGSFPLKFF---SRLGWCVPILMTTVWARCTVMYMDTSLGECLWNYNLTPYYWILEG 478
            .::.|:.|.   ..|:|   ..:||.||...|.||....:.:.|..   | |:...:..:||::|
Human   242 TLLAVSFFS---ERKYFWGYILIGWGVPSTFTMVWTIARIHFEDYG---C-WDTINSSLWWIIKG 299

  Fly   479 PRLAVILLNFCFLVNIIRVLVMKLR--QSQASDIEQTRKAVRAAIVLLPLLGITNLLHQLAP--- 538
            |.|..||:||...:.|||:|:.|||  ..:.||.....:..|:.::|:||.|:..::....|   
Human   300 PILTSILVNFILFICIIRILLQKLRPPDIRKSDSSPYSRLARSTLLLIPLFGVHYIMFAFFPDNF 364

  Fly   539 ---LKTATNFAVWSYGTHFLTSFQGFFIALIYCFLNGEVRAVLLKSLATQLSVRGHPEWAPKRAS 600
               :|......|        .|||||.:|::||||||||:|.|.:.. .:..::|...|.||   
Human   365 KPEVKMVFELVV--------GSFQGFVVAILYCFLNGEVQAELRRKW-RRWHLQGVLGWNPK--- 417

  Fly   601 MY---SGAYNTAPDTDAVQPAGDPSATGKRISPPNKR 634
             |   ||..|.|..:..|...       .|:||..:|
Human   418 -YRHPSGGSNGATCSTQVSML-------TRVSPGARR 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdfrNP_001245501.1 HRM 213..272 CDD:280888 19/58 (33%)
7tm_4 306..563 CDD:304433 78/267 (29%)
VIPR1NP_004615.2 HormR 59..128 CDD:214468 26/86 (30%)
7tm_2 139..384 CDD:278432 78/267 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4564
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D290902at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45620
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.