DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdfr and SCTR

DIOPT Version :9

Sequence 1:NP_001245501.1 Gene:Pdfr / 31234 FlyBaseID:FBgn0260753 Length:738 Species:Drosophila melanogaster
Sequence 2:XP_011509923.1 Gene:SCTR / 6344 HGNCID:10608 Length:445 Species:Homo sapiens


Alignment Length:390 Identity:109/390 - (27%)
Similarity:176/390 - (45%) Gaps:74/390 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 CNWTWDTLLCWPPTPAGVLARMNCPGGFHGVDTRKFAI-RKCELDGRWGS---RPN-ATEVNPPG 275
            |...||.:.|||.:..|.:..:.||.....:.:|..:: |.|..|| |..   ||| |..||   
Human    66 CEGMWDNISCWPSSVPGRMVEVECPRFLRMLTSRNGSLFRNCTQDG-WSETFPRPNLACGVN--- 126

  Fly   276 WTDYGPCYKPEIIRLMQQMGSKDFDAYIDIARRTRTLEIVGLCLSLFALIVSLLIFCTFRSLRNN 340
                           :....::...:|:   .:.:.:..||...||..|:|:|.|.|.||.|...
Human   127 ---------------VNDSSNEKRHSYL---LKLKVMYTVGYSSSLVMLLVALGILCAFRRLHCT 173

  Fly   341 RTKIHKNLFVAMVLQVIIRL-----------TLYLDQFRRGNKEAATNTSLSVIENTPYLCEASY 394
            |..||.:|||:.:|:.:...           ..|.|..|.|                   |:...
Human   174 RNYIHMHLFVSFILRALSNFIKDAVLFSSDDVTYCDAHRAG-------------------CKLVM 219

  Fly   395 VLLEYARTAMFMWMFIEGLYLHNMVTVAVFQGSFPLKFFSRLGWCVPILMTTVWARCTVMYMDT- 458
            ||.:|...|.:.|:.:||||||.::.::.|.....|:.|...||..|.:...:||.......|. 
Human   220 VLFQYCIMANYSWLLVEGLYLHTLLAISFFSERKYLQGFVAFGWGSPAIFVALWAIARHFLEDVG 284

  Fly   459 --SLGECLWNYNL-TPYYWILEGPRLAVILLNFCFLVNIIRVLVMKLR--QSQASDIEQTRKAVR 518
              || .| |:.|. ...:||:.||.:..||:||...:||:|:|:.|||  :::.:::...::..|
Human   285 CPSL-RC-WDINANASIWWIIRGPVILSILINFILFINILRILMRKLRTQETRGNEVSHYKRLAR 347

  Fly   519 AAIVLLPLLGITNLLHQLAP---LKTATNFAVWSYGTHFLTSFQGFFIALIYCFLNGEVRAVLLK 580
            :.::|:||.||..::...:|   ::....|.:      .|.||||..:|::||||||||:..:.|
Human   348 STLLLIPLFGIHYIVFAFSPEDAMEIQLFFEL------ALGSFQGLVVAVLYCFLNGEVQLEVQK 406

  Fly   581  580
            Human   407  406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdfrNP_001245501.1 HRM 213..272 CDD:280888 19/60 (32%)
7tm_4 306..563 CDD:304433 77/276 (28%)
SCTRXP_011509923.1 HRM 64..126 CDD:280888 19/60 (32%)
7tm_2 139..389 CDD:278432 77/279 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4564
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D290902at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45620
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.