DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdfr and PTH1R

DIOPT Version :9

Sequence 1:NP_001245501.1 Gene:Pdfr / 31234 FlyBaseID:FBgn0260753 Length:738 Species:Drosophila melanogaster
Sequence 2:XP_011532269.1 Gene:PTH1R / 5745 HGNCID:9608 Length:606 Species:Homo sapiens


Alignment Length:485 Identity:137/485 - (28%)
Similarity:207/485 - (42%) Gaps:96/485 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 GLYCNWTWDTLLCWPPTPAGVLARMNCPGGFHGVDTRKFAIRKCELDGRWGSRP--NATEVNPPG 275
            |..|...||.:||||....|.:..:.||...:..:.:..|.|:|:.:|.|...|  |.|      
Human   118 GRPCLPEWDHILCWPLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWELVPGHNRT------ 176

  Fly   276 WTDYGPCYKPEIIRLMQQMGSKDFDAYIDIARRTRTLEI---------VGLCLSLFALIVSLLIF 331
            |.:|..|.|                   .:...||..|:         ||..:||.:|.|::||.
Human   177 WANYSECVK-------------------FLTNETREREVFDRLGMIYTVGYSVSLASLTVAVLIL 222

  Fly   332 CTFRSLRNNRTKIHKNLFVAMVLQVII----RLTLY----LDQFRRGNKEAATNTSLSVIENTP- 387
            ..||.|...|..||.:||::.:|:.:.    ...||    ||:     .|..|...|..|...| 
Human   223 AYFRRLHCTRNYIHMHLFLSFMLRAVSIFVKDAVLYSGATLDE-----AERLTEEELRAIAQAPP 282

  Fly   388 --------YL-CEASYVLLEYARTAMFMWMFIEGLYLHNMVTVAVFQGSFPLKFFSRLGWCVPIL 443
                    |. |..:.....|.....:.|:.:||||||:::.:|.|.....|..|:..||.:|.:
Human   283 PPATAAAGYAGCRVAVTFFLYFLATNYYWILVEGLYLHSLIFMAFFSEKKYLWGFTVFGWGLPAV 347

  Fly   444 MTTVWARCTVMYMDTSLGECLWNYNLTPYYWILEGPRLAVILLNFCFLVNIIRVLVMKLRQSQAS 508
            ...||........:|.   | |:.:.....||::.|.||.|:|||...:||:|||..|||::.|.
Human   348 FVAVWVSVRATLANTG---C-WDLSSGNKKWIIQVPILASIVLNFILFINIVRVLATKLRETNAG 408

  Fly   509 DI---EQTRKAVRAAIVLLPLLGITNLLHQLAPLKTATNFAVWSYGTHF---LTSFQGFFIALIY 567
            ..   :|.||.:::.:||:||.|:..::....|. |..:..:|....|:   ..||||||:|:||
Human   409 RCDTRQQYRKLLKSTLVLMPLFGVHYIVFMATPY-TEVSGTLWQVQMHYEMLFNSFQGFFVAIIY 472

  Fly   568 CFLNGEVRAVLLKSLATQLSVRGHPEWA-----PKRASMYSGAYNTAP--DTDAVQPAGDPSATG 625
            ||.||||:|.:.||.:         .|.     .::|...|.:|:..|  ...:|...|.....|
Human   473 CFCNGEVQAEIKKSWS---------RWTLALDFKRKARSGSSSYSYGPMVSHTSVTNVGPRVGLG 528

  Fly   626 KRISP---PNKRLNGR-------KPSSASI 645
            ..:||   |....||.       ||.:.::
Human   529 LPLSPRLLPTATTNGHPQLPGHAKPGTPAL 558

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdfrNP_001245501.1 HRM 213..272 CDD:280888 19/60 (32%)
7tm_4 306..563 CDD:304433 86/289 (30%)
PTH1RXP_011532269.1 HRM 118..186 CDD:280888 23/92 (25%)
7tm_2 197..468 CDD:278432 83/280 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D290902at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45620
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.