powered by:
Protein Alignment Pdfr and zgc:64002
DIOPT Version :9
Sequence 1: | NP_001245501.1 |
Gene: | Pdfr / 31234 |
FlyBaseID: | FBgn0260753 |
Length: | 738 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001104716.2 |
Gene: | zgc:64002 / 393330 |
ZFINID: | ZDB-GENE-040426-1329 |
Length: | 262 |
Species: | Danio rerio |
Alignment Length: | 30 |
Identity: | 9/30 - (30%) |
Similarity: | 14/30 - (46%) |
Gaps: | 11/30 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 234 LARMNCPGG-----------FHGVDTRKFA 252
|.::.|||| |:.||.:.|:
Zfish 183 LTKLLCPGGLFVMVGVLSETFYKVDEQLFS 212
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Pdfr | NP_001245501.1 |
HRM |
213..272 |
CDD:280888 |
9/30 (30%) |
7tm_4 |
306..563 |
CDD:304433 |
|
zgc:64002 | NP_001104716.2 |
AdoMet_MTases |
2..260 |
CDD:302624 |
9/30 (30%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4564 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.