DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdfr and mthl7

DIOPT Version :9

Sequence 1:NP_001245501.1 Gene:Pdfr / 31234 FlyBaseID:FBgn0260753 Length:738 Species:Drosophila melanogaster
Sequence 2:NP_648181.2 Gene:mthl7 / 38910 FlyBaseID:FBgn0035847 Length:491 Species:Drosophila melanogaster


Alignment Length:264 Identity:55/264 - (20%)
Similarity:100/264 - (37%) Gaps:89/264 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   311 TLEIVGLCLSLFALIVSLLIFCTFRSLRNNRTK----IHKNLFVAMVLQVIIRLTL--------- 362
            :|||  |.:::...::::.::...:.|||...|    ...:.|:..::.::..|.|         
  Fly   222 SLEI--LIITMICFVLTIAVYLYIKKLRNVTGKCIVCCIVSRFIQCLIMILDHLNLLNGICSPAG 284

  Fly   363 YLDQFRRGNKEAATNTSLSVIENTPY-------LCEASYVLLEYARTAMFMWMFIEGLYLHNMVT 420
            |...|.|    .|:|..||||....:       ..:.:|..|.|   ..|:|.           |
  Fly   285 YSSHFFR----MASNLWLSVISYHTWKVLTSLNRVDPNYRFLRY---NAFVWS-----------T 331

  Fly   421 VAVFQGSF----------PLKFFSRLGWCVPILMTTVWARCTVMYMDTSLGECLWNYNLTPYYWI 475
            .|:..||.          |    |:..| :|::   .:.||:|..         |:    |..||
  Fly   332 AAIMTGSIYIVNQIWENDP----SKWNW-LPLV---GFIRCSVKD---------WH----PSVWI 375

  Fly   476 -LEGPRLAVILLNFC-FLVNIIRVLVMKLRQSQASDIEQTR------------KAVRAAIVLLPL 526
             :.||.||:...|.. |.:..|.:..:|...::.::.|:.|            :.:|.:||    
  Fly   376 YISGPSLALSTFNVAMFALTAIYIRKVKGGINKFTNEEEGRINCINFDSQTYLQFLRLSIV---- 436

  Fly   527 LGIT 530
            :|:|
  Fly   437 MGLT 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdfrNP_001245501.1 HRM 213..272 CDD:280888
7tm_4 306..563 CDD:304433 55/264 (21%)
mthl7NP_648181.2 Mth_Ecto 27..214 CDD:299804
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462251
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.