DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdfr and mthl6

DIOPT Version :9

Sequence 1:NP_001245501.1 Gene:Pdfr / 31234 FlyBaseID:FBgn0260753 Length:738 Species:Drosophila melanogaster
Sequence 2:NP_788473.1 Gene:mthl6 / 38839 FlyBaseID:FBgn0035789 Length:480 Species:Drosophila melanogaster


Alignment Length:286 Identity:59/286 - (20%)
Similarity:102/286 - (35%) Gaps:98/286 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   283 YKPEIIRLMQQMGSKDFDAYIDIARRTRTLEIVGLCLSLFALIVSLLIFCTFRSLRNNRTKIHKN 347
            |.|:.:..:.|:|               |:.:|| |      |:::.::...:.|||...|    
  Fly   197 YIPKSMPAVPQVG---------------TISMVG-C------ILTIAVYLYIKKLRNLLGK---- 235

  Fly   348 LFVAMVLQVIIRLTLYLDQFRRGNKEAATNTSLSVIENTPYLCE-ASYVLLEYARTAMFMWMFIE 411
            .|:..|....::..::            ....|::..|   :|. |.|....:|..:.| |:.:.
  Fly   236 CFICYVFCKFVQYLIW------------AGGDLNLWNN---ICSLAGYTNYFFALASHF-WLSVM 284

  Fly   412 GLYL-HNMVTVAVFQGSFPLKFFSRLGWCVPILMTTV-----WA-----------------RCTV 453
            ...: .|:..:...:.|:....::..||..|.:||.:     ||                 ||  
  Fly   285 SHQIWKNLRLINRDERSYHFLIYNIYGWGTPAIMTAITYLVDWAWEDRPDKLNWIPGVGLYRC-- 347

  Fly   454 MYMDTSLGECLWNYNLTPYYW----ILEGPRLAVILLN---FCFLVNIIRVLVMKLRQSQASDIE 511
                       |   :..|.|    .|.||.|.:.|.|   |...||.|    ||::.|..|..:
  Fly   348 -----------W---INTYDWSAMIYLYGPMLILSLFNVVTFILTVNHI----MKIKSSVKSSTQ 394

  Fly   512 QTRKAVRAAIVLLPL-----LGITNL 532
            |.||.::....||.|     :|:|.:
  Fly   395 QQRKCIQNNDFLLYLRLSVMMGVTGI 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdfrNP_001245501.1 HRM 213..272 CDD:280888
7tm_4 306..563 CDD:304433 55/263 (21%)
mthl6NP_788473.1 Mth_Ecto 25..197 CDD:119403 59/286 (21%)
7tm_4 211..398 CDD:304433 47/233 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462252
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.